Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of IFNAR1 expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). IFNAR1 at 64KD was detected using rabbit anti- IFNAR1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Mouse IFNAR1 Polyclonal Antibody | anti-IFNAR1 antibody

Anti-IFNAR1 Antibody

Gene Names
IFNAR1; AVP; IFRC; IFNAR; IFNBR; IFN-alpha-REC
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
IFNAR1; Polyclonal Antibody; Anti-IFNAR1 Antibody; AVP; CRF2-1; IFN alpha REC; IFN-R-1; IFNAR; Ifnar1; IFNBR; IFRC; P17181; Interferon alpha/beta receptor 1; anti-IFNAR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCI, 0.2 mg Na2HPO4, 0.05 mg,NaN3
Sequence Length
557
Applicable Applications for anti-IFNAR1 antibody
Western Blot (WB)
Application Notes
Western Blot:

Concentration: 0.1-0.5ug/ml
Tested Species: Human, Mouse

Tested Species: In- house tested species with positive results.

Other applications have not been tested.

Optimal dilutions should be determined by end users.
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR).
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of IFNAR1 expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). IFNAR1 at 64KD was detected using rabbit anti- IFNAR1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of IFNAR1 expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). IFNAR1 at 64KD was detected using rabbit anti- IFNAR1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-IFNAR1 antibody
Rabbit IgG polyclonal antibody for Interferon alpha/beta receptor 1(IFNAR1) detection.
Background: Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
References
1. "Entrez Gene: IFNAR1 interferon (alpha, beta and omega) receptor 1".
2. Abramovich C, Yakobson B, Chebath J, Revel M (Jan 1997). "A protein-arginine methyltransferase binds to the intracytoplasmic domain of the IFNAR1 chain in the type I interferon receptor". EMBO J. 16 (2): 260-6.
3. Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ (Mar 1996)."Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein". EMBO J. 15 (5): 1064-74.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon alpha/beta receptor 1
NCBI Official Synonym Full Names
interferon alpha and beta receptor subunit 1
NCBI Official Symbol
IFNAR1
NCBI Official Synonym Symbols
AVP; IFRC; IFNAR; IFNBR; IFN-alpha-REC
NCBI Protein Information
interferon alpha/beta receptor 1
UniProt Protein Name
Interferon alpha/beta receptor 1
UniProt Gene Name
IFNAR1
UniProt Synonym Gene Names
IFNAR; IFN-R-1; IFN-alpha/beta receptor 1; CRF2-1

NCBI Description

The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008]

Uniprot Description

IFNAR1: receptor for interferons alpha and beta. Belongs to the type II cytokine family of receptors. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1. Present in all tissues and even on the surface of most IFN-resistant cells.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: interferon-alpha/beta binding; interferon-alpha/beta receptor activity; protein binding

Biological Process: JAK-STAT cascade; response to lipopolysaccharide; response to virus

Research Articles on IFNAR1

Similar Products

Product Notes

The IFNAR1 ifnar1 (Catalog #AAA178600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-IFNAR1 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IFNAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: Concentration: 0.1-0.5ug/ml
Tested Species: Human, Mouse Tested Species: In- house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the IFNAR1 ifnar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFNAR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.