Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IFNA5 expression in transfected 293T cell line by IFNA5 polyclonal antibody. Lane 1: IFNA5 transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human IFNA5 Polyclonal Antibody | anti-IFNA5 antibody

IFNA5 (Interferon alpha-5, IFN-alpha-5, Interferon alpha-61, Interferon alpha-G, LeIF G)

Gene Names
IFNA5; INA5; INFA5; leIF G; IFN-alphaG; IFN-alpha-5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
IFNA5; Polyclonal Antibody; IFNA5 (Interferon alpha-5; IFN-alpha-5; Interferon alpha-61; Interferon alpha-G; LeIF G); Anti -IFNA5 (Interferon alpha-5; anti-IFNA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IFNA5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Applicable Applications for anti-IFNA5 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human IFNA5, aa1-189 (NP_002160.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IFNA5 expression in transfected 293T cell line by IFNA5 polyclonal antibody. Lane 1: IFNA5 transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IFNA5 expression in transfected 293T cell line by IFNA5 polyclonal antibody. Lane 1: IFNA5 transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-IFNA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,942 Da
NCBI Official Full Name
interferon alpha-5
NCBI Official Synonym Full Names
interferon, alpha 5
NCBI Official Symbol
IFNA5
NCBI Official Synonym Symbols
INA5; INFA5; leIF G; IFN-alphaG; IFN-alpha-5
NCBI Protein Information
interferon alpha-5; interferon alpha-G; interferon alpha-61
UniProt Protein Name
Interferon alpha-5
Protein Family
UniProt Gene Name
IFNA5
UniProt Synonym Gene Names
IFN-alpha-5; LeIF G
UniProt Entry Name
IFNA5_HUMAN

Uniprot Description

IFNA5: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Belongs to the alpha/beta interferon family.

Protein type: Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular space; extracellular region

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interferon-alpha/beta receptor binding; cytokine activity

Biological Process: B cell proliferation; adaptive immune response; cytokine and chemokine mediated signaling pathway; regulation of MHC class I biosynthetic process; humoral immune response; T cell activation during immune response; response to exogenous dsRNA; B cell differentiation; natural killer cell activation during immune response; innate immune response; blood coagulation; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein

Research Articles on IFNA5

Similar Products

Product Notes

The IFNA5 ifna5 (Catalog #AAA6001147) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNA5 (Interferon alpha-5, IFN-alpha-5, Interferon alpha-61, Interferon alpha-G, LeIF G) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the IFNA5 ifna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALPFVLLMA LVVLNCKSIC SLGCDLPQTH SLSNRRTLMI MAQMGRISPF SCLKDRHDFG FPQEEFDGNQ FQKAQAISVL HEMIQQTFNL FSTKDSSATW DETLLDKFYT ELYQQLNDLE ACMMQEVGVE DTPLMNVDSI LTVRKYFQRI TLYLTEKKYS PCAWEVVRAE IMRSFSLSAN LQERLRRKE. It is sometimes possible for the material contained within the vial of "IFNA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.