Western Blot (WB)
(Western Blot analysis of IFITM1 expression in transfected 293T cell line by 128253. Lane 1: IFITM1 transfected lysate (13.9kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human IFITM1 Polyclonal Antibody | anti-IFITM1 antibody
IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2a, Interferon-induced Protein 17, Interferon-inducible Protein 9-27, Leu-13 Antigen) (MaxLight 550)
Gene Names
IFITM1; 9-27; CD225; IFI17; LEU13; DSPA2a
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFITM1; Polyclonal Antibody; IFITM1 (CD225; IFI17; Interferon-induced Transmembrane Protein 1; Dispanin Subfamily A Member 2a; Interferon-induced Protein 17; Interferon-inducible Protein 9-27; Leu-13 Antigen) (MaxLight 550); anti-IFITM1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IFITM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-IFITM1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-125 from human IFITM1.
Immunogen Sequence
MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of IFITM1 expression in transfected 293T cell line by 128253. Lane 1: IFITM1 transfected lysate (13.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of IFITM1 expression in transfected 293T cell line by 128253. Lane 1: IFITM1 transfected lysate (13.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IFITM1 antibody
IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus, and dengue virus by inhibiting the early step(s) of replication. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activition or by arresting cell growth in G1 phase in a p53-dependent manner. Implicated in the control of cell growth. Component of a multimeric complex involved in the transduction of antiproliferative and homotypic adhesion signals.
Product Categories/Family for anti-IFITM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
13,964 Da
NCBI Official Full Name
Homo sapiens interferon induced transmembrane protein 1 (9-27), mRNA
NCBI Official Synonym Full Names
interferon induced transmembrane protein 1
NCBI Official Symbol
IFITM1
NCBI Official Synonym Symbols
9-27; CD225; IFI17; LEU13; DSPA2a
NCBI Protein Information
interferon-induced transmembrane protein 1
Protein Family
Research Articles on IFITM1
Similar Products
Product Notes
The IFITM1 (Catalog #AAA6382174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2a, Interferon-induced Protein 17, Interferon-inducible Protein 9-27, Leu-13 Antigen) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFITM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFITM1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFITM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
