Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IFI30 expression in transfected 293T cell line by IFI30 polyclonal antibody. Lane 1: IFI30 transfected lysate (28kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human IFI30 Polyclonal Antibody | anti-IFI30 antibody

IFI30 (Gamma-interferon-inducible Lysosomal Thiol Reductase, Gamma-interferon-inducible Protein IP-30, Legumaturain, GILT, IP30, MGC32056) (FITC)

Gene Names
IFI30; GILT; IP30; IP-30; IFI-30
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFI30; Polyclonal Antibody; IFI30 (Gamma-interferon-inducible Lysosomal Thiol Reductase; Gamma-interferon-inducible Protein IP-30; Legumaturain; GILT; IP30; MGC32056) (FITC); anti-IFI30 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IFI30.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-IFI30 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human IFI30, aa1-250 (NP_006323.2).
Immunogen Sequence
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IFI30 expression in transfected 293T cell line by IFI30 polyclonal antibody. Lane 1: IFI30 transfected lysate (28kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IFI30 expression in transfected 293T cell line by IFI30 polyclonal antibody. Lane 1: IFI30 transfected lysate (28kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IFI30 antibody
Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.
Product Categories/Family for anti-IFI30 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,964 Da
NCBI Official Full Name
gamma-interferon-inducible lysosomal thiol reductase preproprotein
NCBI Official Synonym Full Names
interferon, gamma-inducible protein 30
NCBI Official Symbol
IFI30
NCBI Official Synonym Symbols
GILT; IP30; IP-30; IFI-30
NCBI Protein Information
gamma-interferon-inducible lysosomal thiol reductase; gamma-interferon-inducible protein IP-30; interferon gamma-inducible protein 30 preproprotein; legumaturain
UniProt Protein Name
Gamma-interferon-inducible lysosomal thiol reductase
UniProt Gene Name
IFI30
UniProt Synonym Gene Names
GILT; IP30
UniProt Entry Name
GILT_HUMAN

NCBI Description

The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008]

Uniprot Description

IFI30: Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II- restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation. Belongs to the GILT family.

Protein type: Secreted, signal peptide; EC 1.8.-.-; Secreted

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: lysosomal lumen; intracellular membrane-bound organelle; lysosome; cytoplasm; extracellular region; plasma membrane; cell junction

Molecular Function: oxidoreductase activity, acting on sulfur group of donors

Biological Process: protein stabilization; negative regulation of fibroblast proliferation; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class II

Research Articles on IFI30

Similar Products

Product Notes

The IFI30 ifi30 (Catalog #AAA6382093) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI30 (Gamma-interferon-inducible Lysosomal Thiol Reductase, Gamma-interferon-inducible Protein IP-30, Legumaturain, GILT, IP30, MGC32056) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFI30 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFI30 ifi30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFI30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.