Western Blot (WB)
(Western blot analysis of extracts of rat heart, using IFI27 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Rat IFI27 Polyclonal Antibody | anti-IFI27 antibody
IFI27 Polyclonal Antibody
Gene Names
IFI27; P27; ISG12; FAM14D; ISG12A
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IFI27; Polyclonal Antibody; IFI27 Polyclonal Antibody; FAM14D; ISG12; ISG12A; P27; anti-IFI27 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLT
Sequence Length
122
Applicable Applications for anti-IFI27 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human IFI27
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Mitochondrion, Multi-pass membrane protein
Positive Samples
Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of rat heart, using IFI27 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of rat heart, using IFI27 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-IFI27 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 11kDa
Observed: 12kDa
Observed: 12kDa
NCBI Official Full Name
interferon alpha-inducible protein 27, mitochondrial isoform 1
NCBI Official Synonym Full Names
interferon alpha inducible protein 27
NCBI Official Symbol
IFI27
NCBI Official Synonym Symbols
P27; ISG12; FAM14D; ISG12A
NCBI Protein Information
interferon alpha-inducible protein 27, mitochondrial
UniProt Protein Name
Interferon alpha-inducible protein 27, mitochondrial
Protein Family
UniProt Gene Name
IFI27
UniProt Synonym Gene Names
p27; ISG12(a)
Uniprot Description
Promotes cell death. Mediates IFN-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9.
Research Articles on IFI27
Similar Products
Product Notes
The IFI27 ifi27 (Catalog #AAA9134184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI27 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFI27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the IFI27 ifi27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEASALTSSA VTSVAKVVRV ASGSAVVLPL ARIATVVIGG VVAVPMVLSA MGFTAAGIAS SSIAAKMMSA AAIANGGGVA SGSLVATLQS LGATGLSGLT. It is sometimes possible for the material contained within the vial of "IFI27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
