Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IFI27 expression in transfected 293T cell line by IFI27 polyclonal antibody. Lane 1: IFI27 transfected lysate (11.3kD) Lane 2: Non-transfected lysate)

Rabbit anti-Human IFI27 Polyclonal Antibody | anti-IFI27 antibody

IFI27 (Interferon alpha-inducible Protein 27, Mitochondrial, p27, Interferon alpha-induced 11.5kD Protein, Interferon-stimulated Gene 12a Protein, ISG12(a)) (HRP)

Gene Names
IFI27; P27; ISG12; FAM14D; ISG12A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFI27; Polyclonal Antibody; IFI27 (Interferon alpha-inducible Protein 27; Mitochondrial; p27; Interferon alpha-induced 11.5kD Protein; Interferon-stimulated Gene 12a Protein; ISG12(a)) (HRP); anti-IFI27 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IFI27.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-IFI27 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IFI27, aa1-119 (NP_005523.3).
Immunogen Sequence
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IFI27 expression in transfected 293T cell line by IFI27 polyclonal antibody. Lane 1: IFI27 transfected lysate (11.3kD) Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of IFI27 expression in transfected 293T cell line by IFI27 polyclonal antibody. Lane 1: IFI27 transfected lysate (11.3kD) Lane 2: Non-transfected lysate)
Related Product Information for anti-IFI27 antibody
Treatment of breast carcinoma MCF7 cells with estradiol led to induction of a new 27kD protein, the cDNA was later cloned and identified as p27. This highly hydrophobic protein of 122aa has 33% overall sequence similarity to the product of the 6-16 gene, that is induced by alfa/beta type interferons. It has been shown that p27 is transcriptionally induced by interferon-alpha in various human cell lines. The induction induced by interferon alpha is independent of the presence of estradiol receptors on the cells. High levels of p27 mRNA, detected by Northern blotting, was found in 50% of the primary breast carcinoma cells, suggesting p27 can be a test marker for breast carcinoma detection. Examination of p27 expression by in situ hybridization in p27 over-expressing tumors suggest that p27 gene is localized in cancer cells and sometimes also in fibroblastic cells of tumor stroma. IFI27 mRNA expression is highly up-regulated in lesional psoriatic epidermis and in non-lesional keratinocytes. It was also expressed in lichen planus, chronic eczema, cutaneous squamous cell cancers, and during normal wound repair IFI27 was found in the proliferating subpopulation of keratinocytes. Further studies are now necessary to elucidate the cause of p27 gene overexpression in breast carcinoma and in particular to determine whether it corresponds to chromosomal rearrangements in the 14q32 region and/or to induction by interferons of the alpha/beta type.
Product Categories/Family for anti-IFI27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon alpha-inducible protein 27, mitochondrial isoform 2
NCBI Official Synonym Full Names
interferon alpha inducible protein 27
NCBI Official Symbol
IFI27
NCBI Official Synonym Symbols
P27; ISG12; FAM14D; ISG12A
NCBI Protein Information
interferon alpha-inducible protein 27, mitochondrial
UniProt Protein Name
Interferon alpha-inducible protein 27, mitochondrial
UniProt Gene Name
IFI27
UniProt Synonym Gene Names
p27; ISG12(a)
UniProt Entry Name
IFI27_HUMAN

Uniprot Description

IFI27: Promotes cell death. Mediates IFN-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9. Belongs to the IFI6/IFI27 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 14q32

Cellular Component: integral to membrane; mitochondrial outer membrane; mitochondrion; nuclear inner membrane

Molecular Function: lamin binding

Biological Process: caspase activation; negative regulation of transcription from RNA polymerase II promoter; regulation of protein export from nucleus

Research Articles on IFI27

Similar Products

Product Notes

The IFI27 ifi27 (Catalog #AAA6382083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI27 (Interferon alpha-inducible Protein 27, Mitochondrial, p27, Interferon alpha-induced 11.5kD Protein, Interferon-stimulated Gene 12a Protein, ISG12(a)) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFI27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFI27 ifi27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFI27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.