Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IFI16Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human IFI16 Polyclonal Antibody | anti-IFI16 antibody

IFI16 Antibody - middle region

Gene Names
IFI16; PYHIN2; IFNGIP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IFI16; Polyclonal Antibody; IFI16 Antibody - middle region; anti-IFI16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTTFPESHLRTPQMPPTT
Sequence Length
729
Applicable Applications for anti-IFI16 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human IFI16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IFI16Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IFI16Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IFI16 antibody
This is a rabbit polyclonal antibody against IFI16. It was validated on Western Blot

Target Description: This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-IFI16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
gamma-interferon-inducible protein 16 isoform 2
NCBI Official Synonym Full Names
interferon gamma inducible protein 16
NCBI Official Symbol
IFI16
NCBI Official Synonym Symbols
PYHIN2; IFNGIP1
NCBI Protein Information
gamma-interferon-inducible protein 16
UniProt Protein Name
Gamma-interferon-inducible protein 16
UniProt Gene Name
IFI16
UniProt Synonym Gene Names
IFNGIP1; Ifi-16
UniProt Entry Name
IF16_HUMAN

NCBI Description

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2011]

Uniprot Description

IFI16: a nuclear protein that may function as a transcriptional repressor. Strongly induced by gamma interferon and, to a lesser extent, by alpha interferon. Binds double-stranded DNA and cell cycle regulatory factors including p53 and Rb. Loss of IFI16 activates p53 checkpoint through NBS1-DNAPK pathway. Inhibits cell growth in the Ras/Raf signaling pathway. May be involved in the senescence of prostate epithelial cells. Expressed in peripheral blood leukocytes, fibroblasts and lymphoid cells. Present in myeloid precursors (CD34+) and throughout monocyte development, but its expression is down-regulated in erythroid and polymorphonuclear precursor cells. Present in prostate, ovary and breast. Four alternatively spliced isoforms have been described. Isoforms-1, -2 and -3 can homo- and hetero-dimerize.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleolus; nuclear speck; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; double-stranded DNA binding; transcription factor binding

Biological Process: positive regulation of cytokine production; transcription, DNA-dependent; monocyte differentiation; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic; negative regulation of DNA binding; cellular response to glucose starvation; cell proliferation; positive regulation of interleukin-1 beta production; negative regulation of viral genome replication; negative regulation of innate immune response; positive regulation of interferon type I production; autophagy; innate immune response; myeloid cell differentiation; hemopoiesis; positive regulation of transcription from RNA polymerase II promoter; regulation of autophagy; negative regulation of transcription, DNA-dependent; inflammatory response; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; defense response to virus; activation of innate immune response

Research Articles on IFI16

Similar Products

Product Notes

The IFI16 ifi16 (Catalog #AAA3219209) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI16 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFI16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFI16 ifi16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQIKKKTNPR NNDPKSMKLP QEQRQLPYPS EASTTFPESH LRTPQMPPTT. It is sometimes possible for the material contained within the vial of "IFI16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.