Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ICA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Human ICA1 Polyclonal Antibody | anti-ICA1 antibody

ICA1 Rabbit pAb

Gene Names
ICA1; ICA69; ICAp69
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
ICA1; Polyclonal Antibody; ICA1 Rabbit pAb; ICA69; ICAp69; anti-ICA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQ
Applicable Applications for anti-ICA1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ICA1 (NP_001263407).
Positive Samples
U-87MG, BxPC-3
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ICA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ICA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Human colon using ICA1 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded Human colon using ICA1 Rabbit pAb at dilution of 1:100 (40x lens).)
Related Product Information for anti-ICA1 antibody
Background: This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,558 Da
NCBI Official Full Name
islet cell autoantigen 1 isoform a
NCBI Official Synonym Full Names
islet cell autoantigen 1
NCBI Official Symbol
ICA1
NCBI Official Synonym Symbols
ICA69; ICAp69
NCBI Protein Information
islet cell autoantigen 1
UniProt Protein Name
Islet cell autoantigen 1
Protein Family
UniProt Gene Name
ICA1
UniProt Synonym Gene Names
ICA69; ICAp69; p69
UniProt Entry Name
ICA69_HUMAN

NCBI Description

This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]

Uniprot Description

ICA1: May play a role in neurotransmitter secretion.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: cell junction; cytoplasm; cytosol; dendrite; Golgi apparatus; Golgi membrane; Golgi stack; perinuclear region of cytoplasm; secretory granule membrane; synaptic vesicle membrane

Molecular Function: protein binding; protein domain specific binding

Biological Process: neurotransmitter transport; regulation of insulin secretion; regulation of protein homodimerization activity

Research Articles on ICA1

Similar Products

Product Notes

The ICA1 ica1 (Catalog #AAA9142799) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ICA1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ICA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the ICA1 ica1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGHKCYPWD LQDRYAQDKS VVNKMQQKYW ETKQAFIKAT GKKEDEHVVA SDADLDAKLE LFHSIQRTCL DLSKAIVLYQ KRICFLSQEE NELGKFLRSQ GFQDKTRAGK MMQATGKALC FSSQQRLALR NPLCRFHQEV ETFRHRAISD TWLTVNRMEQ. It is sometimes possible for the material contained within the vial of "ICA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.