Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Rat Hypoxia Inducible Factor 2a Polyclonal Antibody | anti-Hif3a antibody

Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha, HIF-2-alpha, HIF2-alpha, Hif2a, Endothelial PAS Domain-containing Protein 1, Endothelial PAS Domain Protein 1, Epas1, EPAS-1, HLF)

Gene Names
Hif3a; Mop7
Reactivity
Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by immunoaffinity chromatography.
Synonyms
Hypoxia Inducible Factor 2a; Polyclonal Antibody; Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha; Hypoxia-inducible Factor 2-alpha; HIF-2-alpha; HIF2-alpha; Hif2a; Endothelial PAS Domain-containing Protein 1; Endothelial PAS Domain Protein 1; Epas1; EPAS-1; HLF); Anti -Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha; anti-Hif3a antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes rat Hypoxia-inducible factor-2 alpha at 97kD.
Purity/Purification
Affinity Purified
Purified by immunoaffinity chromatography.
Form/Format
Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% Thimerosal, 0.05% sodium azide. Reconstitute with 100ul of sterile dH2O.
Applicable Applications for anti-Hif3a antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in Western Blot and Immunohistochemistry.
Dilution: Western Blot: 1ug/ml
Immunohistochemistry (Paraffin and Formalin): 0.5-1ug/ml
Immunogen
Synthetic peptide corresponding to aa202-240, YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD to rat Hypoxia-inducible factor-2 alpha.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for anti-Hif3a antibody
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters.
Product Categories/Family for anti-Hif3a antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,888 Da
NCBI Official Full Name
hypoxia-inducible factor 3-alpha
NCBI Official Synonym Full Names
hypoxia inducible factor 3, alpha subunit
NCBI Official Symbol
Hif3a
NCBI Official Synonym Symbols
Mop7
NCBI Protein Information
hypoxia-inducible factor 3-alpha; HIF3-alpha; HIF-3 alpha; HIF-3-alpha; HIF3 alpha 1; HIF3-alpha-1; hypoxia inducible factor 3a; hypoxia inducible factor 3 alpha; hypoxia-inducible factor 3 alpha
UniProt Protein Name
Hypoxia-inducible factor 3-alpha
Protein Family
UniProt Gene Name
Hif3a
UniProt Synonym Gene Names
HIF-3-alpha; HIF3-alpha
UniProt Entry Name
HIF3A_RAT

NCBI Description

binds HIF-responsive elements and activates transcription in vitro [RGD, Feb 2006]

Uniprot Description

HIF3A: Involved in adaptive response to hypoxia. Suppresses hypoxia-inducible expression of HIF1A and EPAS1. Binds to core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters. The complex HIF3A-ARNT activates the transcription of reporter genes driven by HRE. Isoform 4 has a dominant-negative function of inactivating HIF1A-mediated transcription. Isoform 4 attenuates the binding of HIF1A to hypoxia-responsive elements (HRE), thus inhibiting HRE-driven transcription. Hypoxia induces down-regulation of isoform 4, leading to activation of HIF1A in hypoxia. Conversely, upon restoring normoxia, the expression of isoform 4 increases and thereby secure an inhibition of HIF1A activity. Isoform 4 may be a negative regulator of hypoxia-inducible gene expression in the kidney and may be involved in renal tumorigenesis. Functions as an inhibitor of angiogenesis in the cornea. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Tumor suppressor

Cellular Component: cytoplasm; nucleus

Molecular Function: protein dimerization activity; signal transducer activity; DNA binding; transcription coactivator activity; transcription factor activity; transcription corepressor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; transcription, DNA-dependent; regulation of transcription, DNA-dependent; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; signal transduction

Research Articles on Hif3a

Similar Products

Product Notes

The Hif3a hif3a (Catalog #AAA622976) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha, HIF-2-alpha, HIF2-alpha, Hif2a, Endothelial PAS Domain-containing Protein 1, Endothelial PAS Domain Protein 1, Epas1, EPAS-1, HLF) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hypoxia Inducible Factor 2a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in Western Blot and Immunohistochemistry. Dilution: Western Blot: 1ug/ml Immunohistochemistry (Paraffin and Formalin): 0.5-1ug/ml. Researchers should empirically determine the suitability of the Hif3a hif3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hypoxia Inducible Factor 2a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.