Rabbit anti-Human Hyaluronoglucosaminidase 1 Polyclonal Antibody | anti-HYAL1 antibody

Hyaluronoglucosaminidase 1 (HYAL1, Hyaluronidase-1, Hyal-1, LuCa-1, LUCA1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1) APC

Cat. Num. AAA6381926

• Gene Names: HYAL1; MPS9; NAT6; LUCA1; HYAL-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Hyaluronoglucosaminidase 1; Polyclonal Antibody; Hyaluronoglucosaminidase 1 (HYAL1; Hyaluronidase-1; Hyal-1; LuCa-1; LUCA1; Hyaluronoglucosaminidase-1; Lung Carcinoma Protein 1) APC; anti-HYAL1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human HYAL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 253

• Applicable Applications for anti-HYAL1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human HYAL1, aa1-253 (NP_695015.1).
• Immunogen Sequence: MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HYAL1 expression in transfected 293T cell line by HYAL1 polyclonal antibody. Lane 1: HYAL1 transfected lysate (28kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-HYAL1 antibody

Hyaluronidase is an enzyme that temporarily and reversibly breaks down the polysaccharide, hyaluronic acid, which is found between the cells of connective tissue. Hyaluronic acid may be thought of as the "glue" that holds cells together. hyaluronic acid is a mucopolysaccharide that exists in the human tissue matrix. It can constrain the diffusion of the extracellular fluid. Hyaluronidase makes the glucoseamine of the hyaluronic acid molecules hydrolyzed and depolymerized, thus decreases the viscosity of the body fluids and increases the flow and diffusion of the intercellular fluids. In this way the physic liquor, exudates or blood in local areas can be more easily diffused, and the drug can be more easily absorbed. Thus the local tissue tension and pains can be relieved. And it will also be easier for the edema and inflammatory exudates to be absorbed and dissolved. This product is a basic component of the articular cartilage. It can nourish, protect and maintain the functions of the joints.

Product Categories/Family for anti-HYAL1 antibody

Antibodies; Enzymes; Glycosidase

NCBI and Uniprot Product Information

• NCBI GI #: 24497568
• NCBI GeneID: 3373
• NCBI Accession #: NP_695015.1
• NCBI GenBank Nucleotide #: NM_153283.1
• UniProt Accession #: Q12794
• NCBI Official Full Name: hyaluronidase-1 isoform 3
• NCBI Official Synonym Full Names: hyaluronidase 1
• NCBI Official Symbol: HYAL1
• NCBI Official Synonym Symbols: MPS9; NAT6; LUCA1; HYAL-1
• NCBI Protein Information: hyaluronidase-1
• UniProt Protein Name: Hyaluronidase-1
• UniProt Gene Name: HYAL1
• UniProt Synonym Gene Names: LUCA1; Hyal-1; LuCa-1
• UniProt Entry Name: HYAL1_HUMAN

NCBI Description

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HYAL1: May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth. Defects in HYAL1 are the cause of mucopolysaccharidosis type 9 (MPS9); also called hyaluronidase deficiency. MPS9 is a lysosomal storage disease characterized by high hyaluronan (HA) concentration in the serum. The clinical features are periarticular soft tissue masses, mild short stature and acetabular erosions, and absence of neurological or visceral involvement. Belongs to the glycosyl hydrolase 56 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.2.1.35; Glycan Metabolism - glycosaminoglycan degradation; Secreted, signal peptide; Secreted; Hydrolase

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: extracellular space; lysosomal lumen; lysosome; cytoplasm; cytoplasmic vesicle

Molecular Function: viral receptor activity; hyaluronan synthase activity; transcription factor binding; hyalurononglucosaminidase activity

Biological Process: positive regulation of cell adhesion; glycosaminoglycan metabolic process; response to virus; pathogenesis; positive regulation of cell growth; hyaluronan catabolic process; response to antibiotic; chondroitin sulfate metabolic process; positive regulation of angiogenesis; response to reactive oxygen species; hyaluronan biosynthetic process; cartilage development; carbohydrate metabolic process; chondroitin sulfate catabolic process; negative regulation of cell growth; inflammatory response; hyaluronan metabolic process; positive regulation of growth; positive regulation of epithelial cell proliferation

Disease: Mucopolysaccharidosis, Type Ix