Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HYAL1Sample Tissue: Mouse SP2/0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse HYAL1 Polyclonal Antibody | anti-HYAL1 antibody

HYAL1 Antibody-middle region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HYAL1; Polyclonal Antibody; HYAL1 Antibody-middle region; hyaluronidase-1; Hya1; Hyal-1; anti-HYAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
ELGTYPYYTPTGEPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAV
Applicable Applications for anti-HYAL1 antibody
Western Blot (WB)
Protein Size
462 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HYAL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HYAL1Sample Tissue: Mouse SP2/0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HYAL1Sample Tissue: Mouse SP2/0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HYAL1 antibody
Description of Target: May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
50kDa
UniProt Protein Name
Hyaluronidase-1
UniProt Gene Name
Hyal1
UniProt Synonym Gene Names
Hyal-1
UniProt Entry Name
HYAL1_MOUSE

Uniprot Description

HYAL1: May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth. Defects in HYAL1 are the cause of mucopolysaccharidosis type 9 (MPS9); also called hyaluronidase deficiency. MPS9 is a lysosomal storage disease characterized by high hyaluronan (HA) concentration in the serum. The clinical features are periarticular soft tissue masses, mild short stature and acetabular erosions, and absence of neurological or visceral involvement. Belongs to the glycosyl hydrolase 56 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Secreted, signal peptide; EC 3.2.1.35; Glycan Metabolism - glycosaminoglycan degradation; Secreted

Cellular Component: extracellular space; lysosome; cytoplasm; extracellular region; cytoplasmic vesicle

Molecular Function: viral receptor activity; hydrolase activity; hydrolase activity, acting on glycosyl bonds; hyaluronan synthase activity; transcription factor binding; catalytic activity; hyalurononglucosaminidase activity

Biological Process: positive regulation of cell adhesion; metabolic process; response to virus; positive regulation of cell growth; hyaluronan catabolic process; response to antibiotic; response to reactive oxygen species; positive regulation of angiogenesis; hyaluronan biosynthetic process; carbohydrate metabolic process; negative regulation of cell growth; inflammatory response; hyaluronan metabolic process; positive regulation of growth; positive regulation of epithelial cell proliferation

Similar Products

Product Notes

The HYAL1 hyal1 (Catalog #AAA3249812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HYAL1 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HYAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HYAL1 hyal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELGTYPYYTP TGEPVFGGLP QNASLVTHLA HTFQDIKAAM PEPDFSGLAV. It is sometimes possible for the material contained within the vial of "HYAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.