Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HSPBP1 expression in transfected 293T cell line by HSPBP1 polyclonal antibody. Lane 1: HSPBP1 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HSPBP1 Polyclonal Antibody | anti-HSPBP1 antibody

HSPBP1 (HSPBP, Hsp70-binding Protein 1, Heat Shock Protein-binding Protein 1, Hsp70-binding Protein 2, Hsp70-interacting Protein 1, Hsp70-interacting Protein 2, HspBP2, PP1845, FES1) (AP)

Gene Names
HSPBP1; FES1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSPBP1; Polyclonal Antibody; HSPBP1 (HSPBP; Hsp70-binding Protein 1; Heat Shock Protein-binding Protein 1; Hsp70-binding Protein 2; Hsp70-interacting Protein 1; Hsp70-interacting Protein 2; HspBP2; PP1845; FES1) (AP); anti-HSPBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSPBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HSPBP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HSPBP1, aa1-679 (NP_036399.3).
Immunogen Sequence
MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HSPBP1 expression in transfected 293T cell line by HSPBP1 polyclonal antibody. Lane 1: HSPBP1 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSPBP1 expression in transfected 293T cell line by HSPBP1 polyclonal antibody. Lane 1: HSPBP1 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HSPBP1 antibody
Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.
Product Categories/Family for anti-HSPBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,516 Da
NCBI Official Full Name
hsp70-binding protein 1 isoform 2
NCBI Official Synonym Full Names
HSPA (Hsp70) binding protein 1
NCBI Official Symbol
HSPBP1
NCBI Official Synonym Symbols
FES1
NCBI Protein Information
hsp70-binding protein 1
UniProt Protein Name
Hsp70-binding protein 1
Protein Family
UniProt Gene Name
HSPBP1
UniProt Synonym Gene Names
HSPBP; HspBP1; HspBP2
UniProt Entry Name
HPBP1_HUMAN

Uniprot Description

HSPBP1: Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 19q13.42

Molecular Function: enzyme inhibitor activity; protein binding

Biological Process: protein folding; positive regulation of protein ubiquitination; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of catalytic activity

Research Articles on HSPBP1

Similar Products

Product Notes

The HSPBP1 hspbp1 (Catalog #AAA6381870) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPBP1 (HSPBP, Hsp70-binding Protein 1, Heat Shock Protein-binding Protein 1, Hsp70-binding Protein 2, Hsp70-interacting Protein 1, Hsp70-interacting Protein 2, HspBP2, PP1845, FES1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSPBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSPBP1 hspbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.