Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HSPB1 rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.)

Rabbit anti-Human HSPB1 Polyclonal Antibody | anti-HSPB1 antibody

HSPB1 (Heat Shock Protein beta-1, HspB1, Heat Shock 27kD Protein, HSP 27, Stress-responsive Protein 27, SRP27, Estrogen-regulated 24kD Protein, 28kD Heat Shock Protein, HSPB1, HSP27) APC

Gene Names
HSPB1; CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSPB1; Polyclonal Antibody; HSPB1 (Heat Shock Protein beta-1; HspB1; Heat Shock 27kD Protein; HSP 27; Stress-responsive Protein 27; SRP27; Estrogen-regulated 24kD Protein; 28kD Heat Shock Protein; HSP27) APC; anti-HSPB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSPB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HSPB1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HSPB1, aa1-205 (NP_001531.1).
Immunogen Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(HSPB1 rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.)

Western Blot (WB) (HSPB1 rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of HSPB1 expression in transfected 293T cell line by HSPB1 polyclonal antibody. Lane 1: HSPB1 transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSPB1 expression in transfected 293T cell line by HSPB1 polyclonal antibody. Lane 1: HSPB1 transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPB1 and EGFR. HeLa cells were stained with HSPB1 rabbit purified polyclonal 1:1200 and EGFR mouse purified polyclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPB1 and EGFR. HeLa cells were stained with HSPB1 rabbit purified polyclonal 1:1200 and EGFR mouse purified polyclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPB1 and F13A1. Huh7 cells were stained with HSPB1 rabbit purified polyclonal 1:1200 and F13A1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPB1 and F13A1. Huh7 cells were stained with HSPB1 rabbit purified polyclonal 1:1200 and F13A1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-HSPB1 antibody
In response to adverse changes in their environment, cells from many organisms increase the expression of a class of proteins referred to as heat shock or stress proteins. HSBP1 exhibits rapid increased phosphorylation in response to various mitogens, tumor promoters (e.g. phorbol esters) and calcium ionophores, and high levels are associated with carcinoma of the breast and with endometrial adenocarcinomas. Heat shock of HeLa cell cultures, or treatment with arsenite, phorbol ester, or tumor necrosis factor, causes a rapid phosphorylation of preexisting HSBP1, with Ser82 as the major site and Ser78 the minor site of phosphorylation. HSBP1 may exert phosphorylation-activated functions linked with growth signaling pathways in unstressed cells. A homeostatic function at this level could protect cells from adverse effects of signal transduction systems which may be activated inappropriately during stress.
Product Categories/Family for anti-HSPB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,783 Da
NCBI Official Full Name
heat shock protein beta-1
NCBI Official Synonym Full Names
heat shock 27kDa protein 1
NCBI Official Symbol
HSPB1
NCBI Official Synonym Symbols
CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067
NCBI Protein Information
heat shock protein beta-1; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; heat shock 27kD protein 1; stress-responsive protein 27; estrogen-regulated 24 kDa protein
UniProt Protein Name
Heat shock protein beta-1
Protein Family
UniProt Gene Name
HSPB1
UniProt Synonym Gene Names
HSP27; HSP28; HspB1; HSP 27; SRP27
UniProt Entry Name
HSPB1_HUMAN

NCBI Description

The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq, Oct 2008]

Uniprot Description

HSP27: a small heat shock protein that is regulated both transcriptionally and posttranslationally. Modulates actin polymerization and reorganization. Its expression level increases several-fold in response to stress and is phosphorylated by MAPKAP kinase 2. Cytoplasmic in interphase cells. Colocalizes with mitotic spindles in mitotic cells. Translocates to the nucleus during heat shock.

Protein type: Chaperone; Motility/polarity/chemotaxis; Heat shock protein

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: proteasome complex; extracellular space; focal adhesion; cytoskeleton; cytoplasm; plasma membrane; spindle; cytosol; Z disc; nucleus

Molecular Function: protein kinase C inhibitor activity; identical protein binding; ubiquitin binding; protein binding; protein kinase C binding; protein kinase binding

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; response to virus; positive regulation of blood vessel endothelial cell migration; response to unfolded protein; positive regulation of interleukin-1 beta production; retinal homeostasis; positive regulation of angiogenesis; negative regulation of protein kinase activity; gene expression; vascular endothelial growth factor receptor signaling pathway; cell motility; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of translational initiation; negative regulation of apoptosis

Disease: Neuronopathy, Distal Hereditary Motor, Type Iib; Charcot-marie-tooth Disease, Axonal, Type 2f

Research Articles on HSPB1

Similar Products

Product Notes

The HSPB1 hspb1 (Catalog #AAA6381860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPB1 (Heat Shock Protein beta-1, HspB1, Heat Shock 27kD Protein, HSP 27, Stress-responsive Protein 27, SRP27, Estrogen-regulated 24kD Protein, 28kD Heat Shock Protein, HSPB1, HSP27) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSPB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSPB1 hspb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.