Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HSPB1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human HSPB1 Polyclonal Antibody | anti-HSPB1 antibody

HSPB1 antibody - C-terminal region

Gene Names
HSPB1; CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
HSPB1; Polyclonal Antibody; HSPB1 antibody - C-terminal region; anti-HSPB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Sequence Length
205
Applicable Applications for anti-HSPB1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HSPB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HSPB1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-HSPB1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-HSPB1 antibody
This is a rabbit polyclonal antibody against HSPB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HSPB1, like the other heat shock proteins, is part of a complex system of molecular chaperones in epidermal keratinocytes.
Product Categories/Family for anti-HSPB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
heat shock protein beta-1
NCBI Official Synonym Full Names
heat shock protein family B (small) member 1
NCBI Official Symbol
HSPB1
NCBI Official Synonym Symbols
CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102
NCBI Protein Information
heat shock protein beta-1
UniProt Protein Name
Heat shock protein beta-1
Protein Family
UniProt Gene Name
HSPB1
UniProt Synonym Gene Names
HSP27; HSP28; HspB1; HSP 27; SRP27
UniProt Entry Name
HSPB1_HUMAN

NCBI Description

This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. [provided by RefSeq, Aug 2017]

Uniprot Description

HSP27: a small heat shock protein that is regulated both transcriptionally and posttranslationally. Modulates actin polymerization and reorganization. Its expression level increases several-fold in response to stress and is phosphorylated by MAPKAP kinase 2. Cytoplasmic in interphase cells. Colocalizes with mitotic spindles in mitotic cells. Translocates to the nucleus during heat shock.

Protein type: Chaperone; Motility/polarity/chemotaxis; Heat shock protein

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: proteasome complex; extracellular space; focal adhesion; cytoskeleton; cytoplasm; plasma membrane; spindle; cytosol; Z disc; nucleus

Molecular Function: protein kinase C inhibitor activity; identical protein binding; ubiquitin binding; protein binding; protein kinase C binding; protein kinase binding

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; response to virus; positive regulation of blood vessel endothelial cell migration; response to unfolded protein; positive regulation of interleukin-1 beta production; retinal homeostasis; positive regulation of angiogenesis; negative regulation of protein kinase activity; gene expression; vascular endothelial growth factor receptor signaling pathway; cell motility; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of translational initiation; negative regulation of apoptosis

Disease: Neuronopathy, Distal Hereditary Motor, Type Iib; Charcot-marie-tooth Disease, Axonal, Type 2f

Research Articles on HSPB1

Similar Products

Product Notes

The HSPB1 hspb1 (Catalog #AAA3224464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPB1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSPB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSPB1 hspb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLSPEGTLTV EAPMPKLATQ SNEITIPVTF ESRAQLGGPE AAKSDETAAK. It is sometimes possible for the material contained within the vial of "HSPB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.