Western Blot (WB)
(Western blot analysis of extracts of LO2 cells, using HSPA12B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human HSPA12B Polyclonal Antibody | anti-HSPA12B antibody
HSPA12B Polyclonal Antibody
Gene Names
HSPA12B; C20orf60
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
HSPA12B; Polyclonal Antibody; HSPA12B Polyclonal Antibody; C20orf60; anti-HSPA12B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VPGRHPPEKLLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAEDARFITDPGVRKCGALSLELEPADCGQDTAGAPPGRREIRAAMQFGDTEIKVTAVDVSTNRSVRASIDFLSN
Sequence Length
685
Applicable Applications for anti-HSPA12B antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human HSPA12B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
LO2
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of LO2 cells, using HSPA12B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of LO2 cells, using HSPA12B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-HSPA12B antibody
The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-HSPA12B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 75kDa
Observed: 72kDa
Observed: 72kDa
NCBI Official Full Name
heat shock 70 kDa protein 12B isoform 2
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 12B
NCBI Official Symbol
HSPA12B
NCBI Official Synonym Symbols
C20orf60
NCBI Protein Information
heat shock 70 kDa protein 12B
UniProt Protein Name
Heat shock 70 kDa protein 12B
Protein Family
UniProt Gene Name
HSPA12B
UniProt Synonym Gene Names
C20orf60
NCBI Description
The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
Research Articles on HSPA12B
Similar Products
Product Notes
The HSPA12B hspa12b (Catalog #AAA9135192) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA12B Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA12B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the HSPA12B hspa12b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPGRHPPEKL LVRDGRRWCT DVFERFVAAE QSVALGEEVR RSYCPARPGQ RRVLINLYCC AAEDARFITD PGVRKCGALS LELEPADCGQ DTAGAPPGRR EIRAAMQFGD TEIKVTAVDV STNRSVRASI DFLSN. It is sometimes possible for the material contained within the vial of "HSPA12B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
