Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using HSL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Mouse HSL Polyclonal Antibody | anti-HSL antibody

HSL Rabbit pAb

Gene Names
LIPE; HSL; LHS
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
HSL; Polyclonal Antibody; HSL Rabbit pAb; LIPE; AOMS4; FPLD6; LHS; anti-HSL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TLSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
Applicable Applications for anti-HSL antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation: WB: Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human LIPE (NP_005348.2).
Cellular Location
Cell membrane, Cytoplasm, Membrane, caveola, cytosol
Positive Samples
293T, DU145
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using HSL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using HSL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-HSL antibody
Background: The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116,598 Da
NCBI Official Full Name
hormone-sensitive lipase
NCBI Official Synonym Full Names
lipase, hormone-sensitive
NCBI Official Symbol
LIPE
NCBI Official Synonym Symbols
HSL; LHS
NCBI Protein Information
hormone-sensitive lipase; hormone-sensitive lipase testicular isoform
UniProt Protein Name
Hormone-sensitive lipase
UniProt Gene Name
LIPE
UniProt Synonym Gene Names
HSL
UniProt Entry Name
LIPS_HUMAN

NCBI Description

The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids. [provided by RefSeq, Jul 2008]

Uniprot Description

HSL: hormone sensitive lipase is a lipolytic enzyme of the 'GDXG' family. Plays a rate limiting step in triglyceride lipolysis. In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production. Rapidly activated by cAMP-dependent phosphorylation under the influence of catecholamines. Dephosphorylation and inactivation are controlled by insulin.

Protein type: EC 3.1.1.79; Lipase

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: lipid particle; caveola; cytosol

Molecular Function: triacylglycerol lipase activity; hormone-sensitive lipase activity; protein binding; protein kinase binding

Biological Process: cholesterol metabolic process; triacylglycerol catabolic process; diacylglycerol catabolic process; protein amino acid phosphorylation; lipid catabolic process; long-chain fatty acid catabolic process

Disease: Abdominal Obesity-metabolic Syndrome 4

Research Articles on HSL

Similar Products

Product Notes

The HSL lipe (Catalog #AAA9142090) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSL Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HSL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Mouse. Researchers should empirically determine the suitability of the HSL lipe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLSPSTPSDV NFLLPPEDAG EEAEAKNELS PMDRGLGVRA AFPEGFHPRR SSQGATQMPL YSSPIVKNPF MSPLLAPDSM LKSLPPVHIV ACALDPMLDD S. It is sometimes possible for the material contained within the vial of "HSL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.