Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HSD17B14 expression in transfected 293T cell line by HSD17B14 polyclonal antibody. Lane 1: DHRS10 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human HSD17B14 Polyclonal Antibody | anti-Hsd17b14 antibody

HSD17B14 (17-beta-hydroxysteroid Dehydrogenase 14, 17-beta-HSD 14, 17-beta-hydroxysteroid Dehydrogenase DHRS10, Dehydrogenase/Reductase SDR Family Member 10, Retinal Short-chain Dehydrogenase/Reductase retSDR3, DHRS10, SDR3, UNQ502/PRO474)

Gene Names
Hsd17b14; Dhrs10; retSDR3; 0610039E24Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HSD17B14; Polyclonal Antibody; HSD17B14 (17-beta-hydroxysteroid Dehydrogenase 14; 17-beta-HSD 14; 17-beta-hydroxysteroid Dehydrogenase DHRS10; Dehydrogenase/Reductase SDR Family Member 10; Retinal Short-chain Dehydrogenase/Reductase retSDR3; DHRS10; SDR3; UNQ502/PRO474); Anti -HSD17B14 (17-beta-hydroxysteroid Dehydrogenase 14; anti-Hsd17b14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSD17B14.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Applicable Applications for anti-Hsd17b14 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HSD17B14, aa1-270 (NP_057330.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HSD17B14 expression in transfected 293T cell line by HSD17B14 polyclonal antibody. Lane 1: DHRS10 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSD17B14 expression in transfected 293T cell line by HSD17B14 polyclonal antibody. Lane 1: DHRS10 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-Hsd17b14 antibody
HSD17b14 (hydroxysteroid (17beta)dehydrogenase type 14), also called 17bHSD14 or DHRS10, is a cytoplasmic 17beta hydroxy steroid dehydrogenase that is a member of the SDR (shortchain dehydrogenase/reductase) family. It is a 270aa, ~30kD protein with mRNA highly expressed in brain, placenta, liver and kidney. It converts estradiol to estrone, thus inactivating it, and is thought to regulate activity of estrogens and possibly dihydroepiandrosterone (DHEA) in the placenta and central nervous system. Human HSD17b14 shares 80.5% aa sequence identity with mouse and rat HSD17b14.
Product Categories/Family for anti-Hsd17b14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Hsd17b14 protein
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 14
NCBI Official Symbol
Hsd17b14
NCBI Official Synonym Symbols
Dhrs10; retSDR3; 0610039E24Rik
NCBI Protein Information
dehydrogenase/reductase (SDR family) member 10; dehydrogenase/reductase (SDR family) member 10

Similar Products

Product Notes

The Hsd17b14 (Catalog #AAA645024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSD17B14 (17-beta-hydroxysteroid Dehydrogenase 14, 17-beta-HSD 14, 17-beta-hydroxysteroid Dehydrogenase DHRS10, Dehydrogenase/Reductase SDR Family Member 10, Retinal Short-chain Dehydrogenase/Reductase retSDR3, DHRS10, SDR3, UNQ502/PRO474) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Hsd17b14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATGTRYAGK VVVVTGGGRG IGAGIVRAFV NSGARVVICD KDESGGRALE QELPGAVFIL CDVTQEDDVK TLVSETIRRF GRLDCVVNNA GHHPPPQRPE ETSAQGFRQL LELNLLGTYT LTKLALPYLR KSQGNVINIS SLVGAIGQAQ AVPYVATKGA VTAMTKALAL DESPYGVRVN CISPGNIWTP LWEELAALMP DPRATIREGM LAQPLGRMGQ PAEVGAAAVF LASEANFCTG IELLVTGGAE LGYGCKASRS TPVDAPDIPS. It is sometimes possible for the material contained within the vial of "HSD17B14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.