Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HSD17B14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)

Rabbit HSD17B14 Polyclonal Antibody | anti-HSD17B14 antibody

HSD17B14 antibody - N-terminal region

Gene Names
HSD17B14; DHRS10; SDR47C1; retSDR3
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSD17B14; Polyclonal Antibody; HSD17B14 antibody - N-terminal region; anti-HSD17B14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD
Sequence Length
270
Applicable Applications for anti-HSD17B14 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HSD17B14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-HSD17B14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Related Product Information for anti-HSD17B14 antibody
This is a rabbit polyclonal antibody against HSD17B14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.
Product Categories/Family for anti-HSD17B14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
17-beta-hydroxysteroid dehydrogenase 14
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 14
NCBI Official Symbol
HSD17B14
NCBI Official Synonym Symbols
DHRS10; SDR47C1; retSDR3
NCBI Protein Information
17-beta-hydroxysteroid dehydrogenase 14
UniProt Protein Name
17-beta-hydroxysteroid dehydrogenase 14
UniProt Gene Name
HSD17B14
UniProt Synonym Gene Names
DHRS10; SDR3; 17-beta-HSD 14
UniProt Entry Name
DHB14_HUMAN

NCBI Description

17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009]

Uniprot Description

HSD17B14: Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3- beta,17-beta-diol (in vitro). Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Oxidoreductase; EC 1.1.1.-

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: cytosol

Molecular Function: estradiol 17-beta-dehydrogenase activity; protein binding; testosterone 17-beta-dehydrogenase (NADP+) activity

Biological Process: steroid catabolic process

Research Articles on HSD17B14

Similar Products

Product Notes

The HSD17B14 hsd17b14 (Catalog #AAA3213044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B14 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSD17B14 hsd17b14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVVICDKDES GGRALEQELP GAVFILCDVT QEDDVKTLVS ETIRRFGRLD. It is sometimes possible for the material contained within the vial of "HSD17B14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.