Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HSD11B1 rabbit polyclonal antibody. Western Blot analysis of HSD11B1 expression in human liver.)

Rabbit anti-Human HSD11B1 Polyclonal Antibody | anti-HSD11B1 antibody

HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1, 11-DH, 11-beta-HSD1, HDL, HSD11, HSD11B, HSD11L, MGC13539, SDR26C1) (FITC)

Gene Names
HSD11B1; HDL; 11-DH; HSD11; HSD11B; HSD11L; SDR26C1; MGC13539; 11-beta-HSD1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSD11B1; Polyclonal Antibody; HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1; 11-DH; 11-beta-HSD1; HDL; HSD11; HSD11B; HSD11L; MGC13539; SDR26C1) (FITC); anti-HSD11B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSD11B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-HSD11B1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HSD11B1, aa1-292 (NP_005516.1).
Immunogen Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HSD11B1 rabbit polyclonal antibody. Western Blot analysis of HSD11B1 expression in human liver.)

Western Blot (WB) (HSD11B1 rabbit polyclonal antibody. Western Blot analysis of HSD11B1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of HSD11B1 expression in transfected 293T cell line by HSD11B1 polyclonal antibody. Lane 1: HSD11B1 transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSD11B1 expression in transfected 293T cell line by HSD11B1 polyclonal antibody. Lane 1: HSD11B1 transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HSD11B1 antibody
Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
Product Categories/Family for anti-HSD11B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,401 Da
NCBI Official Full Name
corticosteroid 11-beta-dehydrogenase isozyme 1
NCBI Official Synonym Full Names
hydroxysteroid (11-beta) dehydrogenase 1
NCBI Official Symbol
HSD11B1
NCBI Official Synonym Symbols
HDL; 11-DH; HSD11; HSD11B; HSD11L; SDR26C1; MGC13539; 11-beta-HSD1
NCBI Protein Information
corticosteroid 11-beta-dehydrogenase isozyme 1; OTTHUMP00000034649; OTTHUMP00000034650; short chain dehydrogenase/reductase family 26C, member 1
UniProt Protein Name
Corticosteroid 11-beta-dehydrogenase isozyme 1
UniProt Gene Name
HSD11B1
UniProt Synonym Gene Names
HSD11; HSD11L; 11-DH
UniProt Entry Name
DHI1_HUMAN

Uniprot Description

HSD11B1: Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7- ketocholesterol to 7-beta-hydroxycholesterol. Defects in HSD11B1 are a cause of cortisone reductase deficiency (CRD). In CRD, activation of cortisone to cortisol does not occur, resulting in adrenocorticotropin-mediated androgen excess and a phenotype resembling polycystic ovary syndrome (PCOS). Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Lipid Metabolism - androgen and estrogen; Membrane protein, integral; Endoplasmic reticulum; Oxidoreductase; Lipid Metabolism - C21-steroid hormone; EC 1.1.1.146

Chromosomal Location of Human Ortholog: 1q32-q41

Cellular Component: endoplasmic reticulum membrane; membrane; integral to membrane

Molecular Function: 11-beta-hydroxysteroid dehydrogenase activity

Biological Process: steroid metabolic process; glucocorticoid biosynthetic process; lung development

Disease: Cortisone Reductase Deficiency 2

Similar Products

Product Notes

The HSD11B1 hsd11b1 (Catalog #AAA6381686) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1, 11-DH, 11-beta-HSD1, HDL, HSD11, HSD11B, HSD11L, MGC13539, SDR26C1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD11B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSD11B1 hsd11b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD11B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.