Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-HSCB Polyclonal Antibody)

Rabbit anti-Human HSCB Polyclonal Antibody | anti-HSCB antibody

HSCB Polyclonal Antibody

Gene Names
HSCB; JAC1; HSC20; DNAJC20
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
HSCB; Polyclonal Antibody; HSCB Polyclonal Antibody; DNAJC20; HSC20; JAC1; HscB mitochondrial iron-sulfur cluster cochaperone; anti-HSCB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.28 mg/ml (varies by lot)
Sequence Length
235
Applicable Applications for anti-HSCB antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human HSCB (NP_741999.3).
Immunogen Sequence
AASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Positive Samples
A-549, U-87MG, LO2, SGC-7901
Cellular Location
Cytoplasm, Mitochondrion
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-HSCB Polyclonal Antibody)

Western Blot (WB) (Western blot-HSCB Polyclonal Antibody)
Related Product Information for anti-HSCB antibody
This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 27kDa
Observed: 27kDa
NCBI Official Full Name
iron-sulfur cluster co-chaperone protein HscB isoform 1
NCBI Official Synonym Full Names
HscB mitochondrial iron-sulfur cluster cochaperone
NCBI Official Symbol
HSCB
NCBI Official Synonym Symbols
JAC1; HSC20; DNAJC20
NCBI Protein Information
iron-sulfur cluster co-chaperone protein HscB
UniProt Protein Name
Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
Protein Family
UniProt Gene Name
HSCB
UniProt Synonym Gene Names
DNAJC20; HSC20
UniProt Entry Name
HSC20_HUMAN

NCBI Description

This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

HSCB: Acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria. Belongs to the HscB family.

Protein type: Mitochondrial; Chaperone

Chromosomal Location of Human Ortholog: 22q12.1

Cellular Component: centrosome; mitochondrion; cytoplasm; plasma membrane

Molecular Function: protein binding; chaperone binding; metal ion binding

Biological Process: protein folding; iron-sulfur cluster assembly; protein oligomerization

Research Articles on HSCB

Similar Products

Product Notes

The HSCB hscb (Catalog #AAA9140651) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSCB Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSCB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the HSCB hscb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSCB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.