Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit HR Polyclonal Antibody | anti-HR antibody

HR antibody - N-terminal region

Gene Names
HR; AU; MUHH; ALUNC; HYPT4; MUHH1; HSA277165
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HR; Polyclonal Antibody; HR antibody - N-terminal region; anti-HR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLPPEHPCDWPLTPHPWVYSGGQPKVPSAFSLGSKGFYYKDPSIPRLAKE
Sequence Length
1189
Applicable Applications for anti-HR antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-HR antibody
This is a rabbit polyclonal antibody against HR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HR is a protein whose function has been linked to hair growth. A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases. Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127kDa
NCBI Official Full Name
lysine-specific demethylase hairless isoform a
NCBI Official Synonym Full Names
HR lysine demethylase and nuclear receptor corepressor
NCBI Official Symbol
HR
NCBI Official Synonym Symbols
AU; MUHH; ALUNC; HYPT4; MUHH1; HSA277165
NCBI Protein Information
lysine-specific demethylase hairless
UniProt Protein Name
Protein hairless
Protein Family
UniProt Gene Name
HR
UniProt Entry Name
HAIR_HUMAN

NCBI Description

This gene encodes a protein that is involved in hair growth. This protein functions as a transcriptional corepressor of multiple nuclear receptors, including thyroid hormone receptor, the retinoic acid receptor-related orphan receptors and the vitamin D receptors, and it interacts with histone deacetylases. The translation of this protein is modulated by a regulatory open reading frame (ORF) that exists upstream of the primary ORF. Mutations in this upstream ORF cause Marie Unna hereditary hypotrichosis (MUHH), an autosomal dominant form of genetic hair loss. Mutations in this gene also cause autosomal recessive congenital alopecia and atrichia with papular lesions, other diseases resulting in hair loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

HR: May act as a transcription factor that could act on to regulate one of the phases of hair growth. Defects in HR are the cause of alopecia universalis congenita (ALUNC). ALUNC is a rare autosomal recessive form of hair loss characterized by hair follicles without hair. Defects in HR are the cause of atrichia with papular lesions (APL); also known as congenital atrichia. APL is an autosomal recessive disease characterized by papillary lesions over most of the body and almost complete absence of hair. Defects in HR are the cause of hypotrichosis type 4 (HYPT4). An autosomal dominant condition characterized by reduced amount of hair, alopecia, little or no eyebrows, eyelashes or body hair, and coarse, wiry, twisted hair in early childhood. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 8p21.2

Cellular Component: nuclear body; nucleus

Molecular Function: DNA binding; metal ion binding; oxidoreductase activity; transcription factor activity; transcription corepressor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Disease: Hypotrichosis 4; Alopecia Universalis Congenita; Atrichia With Papular Lesions

Research Articles on HR

Similar Products

Product Notes

The HR hr (Catalog #AAA3201232) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HR antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HR hr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLPPEHPCDW PLTPHPWVYS GGQPKVPSAF SLGSKGFYYK DPSIPRLAKE. It is sometimes possible for the material contained within the vial of "HR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.