Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HPS6Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human HPS6 Polyclonal Antibody | anti-HPS6 antibody

HPS6 Antibody - N-terminal region

Gene Names
HPS6; BLOC2S3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HPS6; Polyclonal Antibody; HPS6 Antibody - N-terminal region; anti-HPS6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GARVVAVAALRGRLVWCEERQARAEGPSGSPAAAFSHCVCVRTLEPSGEA
Sequence Length
775
Applicable Applications for anti-HPS6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HPS6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HPS6Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HPS6Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HPS6 antibody
This is a rabbit polyclonal antibody against HPS6. It was validated on Western Blot

Target Description: This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6.
Product Categories/Family for anti-HPS6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
Hermansky-Pudlak syndrome 6 protein
NCBI Official Synonym Full Names
HPS6 biogenesis of lysosomal organelles complex 2 subunit 3
NCBI Official Symbol
HPS6
NCBI Official Synonym Symbols
BLOC2S3
NCBI Protein Information
Hermansky-Pudlak syndrome 6 protein
UniProt Protein Name
Hermansky-Pudlak syndrome 6 protein
UniProt Gene Name
HPS6
UniProt Synonym Gene Names
Ru
UniProt Entry Name
HPS6_HUMAN

NCBI Description

This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq, Jul 2008]

Uniprot Description

HPS6: May regulate the synthesis and function of lysosomes and of highly specialized organelles, such as melanosomes and platelet dense granules. Defects in HPS6 are the cause of Hermansky-Pudlak syndrome type 6 (HPS6). Hermansky-Pudlak syndrome (HPS) is a genetically heterogeneous, rare, autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q24.32

Cellular Component: membrane; endoplasmic reticulum; early endosome membrane

Molecular Function: GTP-dependent protein binding; Rab GTPase binding

Biological Process: organelle organization and biogenesis; melanocyte differentiation; blood coagulation

Disease: Hermansky-pudlak Syndrome 6

Research Articles on HPS6

Similar Products

Product Notes

The HPS6 hps6 (Catalog #AAA3216788) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HPS6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HPS6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HPS6 hps6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GARVVAVAAL RGRLVWCEER QARAEGPSGS PAAAFSHCVC VRTLEPSGEA. It is sometimes possible for the material contained within the vial of "HPS6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.