Western Blot (WB)
(WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Rabbit anti-Human HOXD1 Polyclonal Antibody | anti-HOXD1 antibody
HOXD1 antibody - middle region
Gene Names
HOXD1; HOX4; HOX4G; Hox-4.7
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HOXD1; Polyclonal Antibody; HOXD1 antibody - middle region; anti-HOXD1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP
Sequence Length
328
Applicable Applications for anti-HOXD1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HOXD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-HOXD1 antibody
This is a rabbit polyclonal antibody against HOXD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene
Target Description: HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene
Product Categories/Family for anti-HOXD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
homeobox protein Hox-D1
NCBI Official Synonym Full Names
homeobox D1
NCBI Official Symbol
HOXD1
NCBI Official Synonym Symbols
HOX4; HOX4G; Hox-4.7
NCBI Protein Information
homeobox protein Hox-D1
UniProt Protein Name
Homeobox protein Hox-D1
Protein Family
UniProt Gene Name
HOXD1
UniProt Synonym Gene Names
HOX4; HOX4G
UniProt Entry Name
HXD1_HUMAN
NCBI Description
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. [provided by RefSeq, Jul 2008]
Research Articles on HOXD1
Similar Products
Product Notes
The HOXD1 hoxd1 (Catalog #AAA3213608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXD1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HOXD1 hoxd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QNRRMKQKKR EREGLLATAI PVAPLQLPLS GTTPTKFIKN PGSPSQSQEP. It is sometimes possible for the material contained within the vial of "HOXD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
