Western Blot (WB)
(Host: RabbitTarget Name: Hoxc6Sample Type: Rat Small Intestine lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Hoxc6 Polyclonal Antibody | anti-HOXC6 antibody
Hoxc6 Antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Hoxc6; Polyclonal Antibody; Hoxc6 Antibody - middle region; anti-HOXC6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ
Sequence Length
235
Applicable Applications for anti-HOXC6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Hoxc6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Hoxc6Sample Type: Rat Small Intestine lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Hoxc6Sample Type: Rat Small Intestine lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HOXC6 antibody
This is a rabbit polyclonal antibody against Hoxc6. It was validated on Western Blot
Target Description: Hoxc6 is a member of the homeobox family.
Target Description: Hoxc6 is a member of the homeobox family.
Product Categories/Family for anti-HOXC6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
homeobox protein Hox-C6
NCBI Official Synonym Full Names
homeo box C6
NCBI Official Symbol
Hoxc6
NCBI Protein Information
homeo box C6; homeobox protein Hox-C6
Protein Family
NCBI Description
member of the homeobox family [RGD, Feb 2006]
Research Articles on HOXC6
Similar Products
Product Notes
The HOXC6 (Catalog #AAA3200381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hoxc6 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Hoxc6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HOXC6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFSSEQGRTA PQDQKASIQI YPWMQRMNSH SGVGYGADRR RGRQIYSRYQ. It is sometimes possible for the material contained within the vial of "Hoxc6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
