Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-HOXB13 Polyclonal Antibody)

Rabbit HOXB13 Polyclonal Antibody | anti-HOXB13 antibody

HOXB13 Polyclonal Antibody

Gene Names
HOXB13; HPC9; PSGD
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
HOXB13; Polyclonal Antibody; HOXB13 Polyclonal Antibody; PSGD; homeobox B13; anti-HOXB13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.95 mg/ml (varies by lot)
Sequence Length
284
Applicable Applications for anti-HOXB13 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HOXB13 (NP_006352.2).
Immunogen Sequence
PLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQ
Positive Samples
DU145, HeLa, HT-29, Mouse Small Intestine, Rat Small Intestine
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-HOXB13 Polyclonal Antibody)

Western Blot (WB) (Western blot-HOXB13 Polyclonal Antibody)
Related Product Information for anti-HOXB13 antibody
This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 30kDa
Observed: 27kDa
NCBI Official Full Name
homeobox protein Hox-B13
NCBI Official Synonym Full Names
homeobox B13
NCBI Official Symbol
HOXB13
NCBI Official Synonym Symbols
HPC9; PSGD
NCBI Protein Information
homeobox protein Hox-B13
UniProt Protein Name
Homeobox protein Hox-B13
Protein Family
UniProt Gene Name
HOXB13
UniProt Entry Name
HXB13_HUMAN

NCBI Description

This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXB13: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Abd-B homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: sequence-specific DNA binding

Biological Process: epidermis development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; regulation of growth; response to wounding; response to testosterone stimulus; angiogenesis

Research Articles on HOXB13

Similar Products

Product Notes

The HOXB13 hoxb13 (Catalog #AAA9140499) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXB13 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HOXB13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the HOXB13 hoxb13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXB13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.