Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using HNRNPCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human HNRNPCL1 Polyclonal Antibody | anti-HNRNPCL1 antibody

HNRNPCL1 Rabbit pAb

Gene Names
HNRNPCL1; HNRPCL1; RP5-845O24.4
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
HNRNPCL1; Polyclonal Antibody; HNRNPCL1 Rabbit pAb; HNRPCL1; anti-HNRNPCL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS
Applicable Applications for anti-HNRNPCL1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HNRNPCL1 (NP_001013653.1).
Cellular Location
Nucleus
Positive Samples
THP-1, MCF7
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using HNRNPCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using HNRNPCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of U2OS cells using HNRNPCL1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of U2OS cells using HNRNPCL1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,142 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein C-like 1
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein C-like 1
NCBI Official Symbol
HNRNPCL1
NCBI Official Synonym Symbols
HNRPCL1; RP5-845O24.4
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein C-like 1; hnRNP C-like-1; hnRNP core protein C-like 1
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein C-like 1
UniProt Gene Name
HNRNPCL1
UniProt Synonym Gene Names
HNRPCL1; hnRNP C-like-1
UniProt Entry Name
HNRCL_HUMAN

Uniprot Description

hnRNP CL1: May play a role in nucleosome assembly by neutralizing basic proteins such as A and B core hnRNPs. Belongs to the RRM HNRPC family. RALY subfamily.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 1p36.21

Cellular Component: ribonucleoprotein complex; nucleus

Molecular Function: nucleotide binding

Similar Products

Product Notes

The HNRNPCL1 hnrnpcl1 (Catalog #AAA9142146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRNPCL1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPCL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the HNRNPCL1 hnrnpcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NLEKIEKEQS KQEVEVKNAK SEEEQSSSSM KKDETHVKME SEGGAEDSAE EGDPLDDDVN EDQGDDQLEL IKDDEKEAEE GEDDRDSTNG QDDS. It is sometimes possible for the material contained within the vial of "HNRNPCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.