Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Rabbit HNMT Polyclonal Antibody | anti-HNMT antibody

HNMT antibody - N-terminal region

Gene Names
HNMT; HMT; MRT51; HNMT-S1; HNMT-S2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HNMT; Polyclonal Antibody; HNMT antibody - N-terminal region; anti-HNMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP
Sequence Length
292
Applicable Applications for anti-HNMT antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 77%; Pig: 92%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HNMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-HNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-HNMT antibody
This is a rabbit polyclonal antibody against HNMT. It was validated on Western Blot

Target Description: In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.
Product Categories/Family for anti-HNMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
histamine N-methyltransferase isoform 1
NCBI Official Synonym Full Names
histamine N-methyltransferase
NCBI Official Symbol
HNMT
NCBI Official Synonym Symbols
HMT; MRT51; HNMT-S1; HNMT-S2
NCBI Protein Information
histamine N-methyltransferase
UniProt Protein Name
Histamine N-methyltransferase
UniProt Gene Name
HNMT
UniProt Synonym Gene Names
HMT
UniProt Entry Name
HNMT_HUMAN

NCBI Description

In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HNMT: Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine. Belongs to the methyltransferase superfamily. HNMT family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.8; Amino Acid Metabolism - histidine; Methyltransferase

Chromosomal Location of Human Ortholog: 2q22.1

Cellular Component: nucleoplasm; neuron projection; cytoplasm

Molecular Function: histamine N-methyltransferase activity

Biological Process: methylation; hyperosmotic response; response to tumor cell; response to glucocorticoid stimulus; respiratory gaseous exchange; brain development; response to cocaine; response to amine stimulus

Disease: Asthma, Susceptibility To

Research Articles on HNMT

Similar Products

Product Notes

The HNMT hnmt (Catalog #AAA3214423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNMT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HNMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HNMT hnmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGIIGRIGDT KSEIKILSIG GGAGEIDLQI LSKVQAQYPG VCINNEVVEP. It is sometimes possible for the material contained within the vial of "HNMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.