Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HMX2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit HMX2 Polyclonal Antibody | anti-HMX2 antibody

HMX2 antibody - middle region

Gene Names
HMX2; H6L; Nkx5-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HMX2; Polyclonal Antibody; HMX2 antibody - middle region; anti-HMX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRS
Sequence Length
273
Applicable Applications for anti-HMX2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HMX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HMX2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-HMX2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-HMX2 antibody
This is a rabbit polyclonal antibody against HMX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HMX2 belongs to the HMX homeobox family. It contains 1 homeobox DNA-binding domain. HMX2 is a transcription factor involved in specification of neuronal cell types and which is required for inner ear and hypothalamus development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
homeobox protein HMX2
NCBI Official Synonym Full Names
H6 family homeobox 2
NCBI Official Symbol
HMX2
NCBI Official Synonym Symbols
H6L; Nkx5-2
NCBI Protein Information
homeobox protein HMX2
UniProt Protein Name
Homeobox protein HMX2
Protein Family
UniProt Gene Name
HMX2
UniProt Entry Name
HMX2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the NKL homeobox family of transcription factors. Members in this family are of ancient origin and play an important role in organ development during embryogenesis. A related mouse protein plays a role in patterning of inner ear structures. In humans, variations in a region containing this gene have been associated with inner ear malformations, vestibular dysfunction, and hearing loss. [provided by RefSeq, Aug 2012]

Uniprot Description

HMX2: Transcription factor involved in specification of neuronal cell types and which is required for inner ear and hypothalamus development. Belongs to the HMX homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 10q26.13

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; inner ear morphogenesis; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; brain development; cell differentiation

Research Articles on HMX2

Similar Products

Product Notes

The HMX2 hmx2 (Catalog #AAA3209966) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMX2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HMX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMX2 hmx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPSHSDFKEE KERLLPAGSP SPGSERPRDG GAERQAGAAK KKTRTVFSRS. It is sometimes possible for the material contained within the vial of "HMX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.