Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HMGCRSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit HMGCR Polyclonal Antibody | anti-HMGCR antibody

HMGCR Antibody - C-terminal region

Gene Names
HMGCR; LDLCQ3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity purified
Synonyms
HMGCR; Polyclonal Antibody; HMGCR Antibody - C-terminal region; anti-HMGCR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVM
Sequence Length
888
Applicable Applications for anti-HMGCR antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HMGCR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HMGCRSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HMGCRSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HMGCR antibody
This is a rabbit polyclonal antibody against HMDH. It was validated on Western Blot

Target Description: HMG-CoA reductase is the rate-limiting enzyme for cholesterol synthesis and is regulated via a negative feedback mechanism mediated by sterols and non-sterol metabolites derived from mevalonate, the product of the reaction catalyzed by reductase. Normally in mammalian cells this enzyme is suppressed by cholesterol derived from the internalization and degradation of low density lipoprotein (LDL) via the LDL receptor. Competitive inhibitors of the reductase induce the expression of LDL receptors in the liver, which in turn increases the catabolism of plasma LDL and lowers the plasma concentration of cholesterol, an important determinant of atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HMGCR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
3-hydroxy-3-methylglutaryl-coenzyme A reductase
NCBI Official Synonym Full Names
3-hydroxy-3-methylglutaryl-CoA reductase
NCBI Official Symbol
HMGCR
NCBI Official Synonym Symbols
LDLCQ3
NCBI Protein Information
3-hydroxy-3-methylglutaryl-Coenzyme A reductase
UniProt Protein Name
3-hydroxy-3-methylglutaryl-coenzyme A reductase
UniProt Gene Name
HMGCR
UniProt Synonym Gene Names
HMG-CoA reductase
UniProt Entry Name
HMDH_HUMAN

NCBI Description

HMG-CoA reductase is the rate-limiting enzyme for cholesterol synthesis and is regulated via a negative feedback mechanism mediated by sterols and non-sterol metabolites derived from mevalonate, the product of the reaction catalyzed by reductase. Normally in mammalian cells this enzyme is suppressed by cholesterol derived from the internalization and degradation of low density lipoprotein (LDL) via the LDL receptor. Competitive inhibitors of the reductase induce the expression of LDL receptors in the liver, which in turn increases the catabolism of plasma LDL and lowers the plasma concentration of cholesterol, an important determinant of atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

HMGCR: the rate-limiting enzyme for cholesterol synthesis. Regulated via a negative feedback mechanism mediated by sterols and non-sterol metabolites derived from mevalonate, the product of the reaction catalyzed by this reductase. Normally in mammalian cells this enzyme is suppressed by cholesterol derived from the internalization and degradation of low density lipoprotein (LDL) via the LDL receptor. Competitive inhibitors of the reductase induce the expression of LDL receptors in the liver, which in turn increases the catabolism of plasma LDL and lowers the plasma concentration of cholesterol, an important determinant of atherosclerosis.

Protein type: EC 1.1.1.34; Secondary Metabolites Metabolism - terpenoid backbone biosynthesis; Endoplasmic reticulum; Membrane protein, integral; Motility/polarity/chemotaxis; Oxidoreductase; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q13.3-q14

Cellular Component: peroxisomal membrane; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; hydroxymethylglutaryl-CoA reductase (NADPH) activity; protein homodimerization activity; hydroxymethylglutaryl-CoA reductase activity; coenzyme binding

Biological Process: negative regulation of MAP kinase activity; isoprenoid biosynthetic process; positive regulation of smooth muscle cell proliferation; positive regulation of skeletal muscle development; cellular lipid metabolic process; cholesterol biosynthetic process; positive regulation of stress-activated MAPK cascade; coenzyme A metabolic process; myoblast differentiation; ubiquinone metabolic process; response to ethanol; negative regulation of vasodilation; visual learning; protein tetramerization; response to nutrient; aging

Research Articles on HMGCR

Similar Products

Product Notes

The HMGCR hmgcr (Catalog #AAA3207327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGCR Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's HMGCR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMGCR hmgcr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSIEIGTVGG GTNLLPQQAC LQMLGVQGAC KDNPGENARQ LARIVCGTVM. It is sometimes possible for the material contained within the vial of "HMGCR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.