Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Hmga1 AntibodyTitration: 2 ug/mlPositive Control: Rat Small Intestine)

Rabbit Hmga1 Polyclonal Antibody | anti-HMGA1 antibody

Hmga1 Antibody - N-terminal region

Gene Names
Hmga1; Hmgi; Hmgiy
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Hmga1; Polyclonal Antibody; Hmga1 Antibody - N-terminal region; anti-HMGA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE
Sequence Length
107
Applicable Applications for anti-HMGA1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hmga1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Hmga1 AntibodyTitration: 2 ug/mlPositive Control: Rat Small Intestine)

Western Blot (WB) (WB Suggested Anti-Hmga1 AntibodyTitration: 2 ug/mlPositive Control: Rat Small Intestine)
Related Product Information for anti-HMGA1 antibody
This is a rabbit polyclonal antibody against Hmga1. It was validated on Western Blot

Target Description: Hmga1 is expressed in metastatic prostate tumors and may be associated with transformation.
Product Categories/Family for anti-HMGA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
high mobility group protein HMG-I/HMG-Y
NCBI Official Synonym Full Names
high mobility group AT-hook 1
NCBI Official Symbol
Hmga1
NCBI Official Synonym Symbols
Hmgi; Hmgiy
NCBI Protein Information
high mobility group protein HMG-I/HMG-Y
UniProt Protein Name
High mobility group protein HMG-I/HMG-Y
UniProt Gene Name
Hmga1
UniProt Synonym Gene Names
HMG-I(Y); High mobility group protein A1
UniProt Entry Name
HMGA1_RAT

NCBI Description

expressed in metastatic prostate tumors; may be associated with transformation [RGD, Feb 2006]

Uniprot Description

HMGA1: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. A chromosomal aberration involving HMGA1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with RAD51B. Belongs to the HMGA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Cellular Component: focal adhesion; nucleus

Molecular Function: retinoid X receptor binding; peroxisome proliferator activated receptor binding; DNA-(apurinic or apyrimidinic site) lyase activity; enzyme binding; ligand-dependent nuclear receptor transcription coactivator activity; DNA binding; retinoic acid receptor binding; 5'-deoxyribose-5-phosphate lyase activity; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; base-excision repair; response to virus; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; negative regulation of transcription, DNA-dependent; DNA catabolic process, endonucleolytic

Research Articles on HMGA1

Similar Products

Product Notes

The HMGA1 hmga1 (Catalog #AAA3202278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hmga1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hmga1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMGA1 hmga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSESGSKSSQ PLASKQEKDG TEKRGRGRPR KQPSVSPGTA LVGSQKEPSE. It is sometimes possible for the material contained within the vial of "Hmga1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.