Rabbit HLA-F Polyclonal Antibody | anti-HLA-F antibody

HLA-F antibody - N-terminal region

Cat. Num. AAA3209437

• Gene Names: HLA-F; HLAF; CDA12; HLA-5.4; HLA-CDA12
• Reactivity: Cow, Human, Pig
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: HLA-F; Polyclonal Antibody; HLA-F antibody - N-terminal region; anti-HLA-F antibody

• Host: Rabbit
• Reactivity: Cow, Human, Pig
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
• Sequence Length: 442

• Applicable Applications for anti-HLA-F antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Human: 100%; Pig: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-HLA-F AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane and cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateHLA-F is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Related Product Information for anti-HLA-F antibody

This is a rabbit polyclonal antibody against HLA-F. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain.

Product Categories/Family for anti-HLA-F antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 149158702
• NCBI GeneID: 3134
• NCBI Accession #: NP_001091949
• NCBI GenBank Nucleotide #: NM_001098479
• UniProt Accession #: P30511
• Molecular Weight: 48kDa
• NCBI Official Full Name: HLA class I histocompatibility antigen, alpha chain F isoform 1
• NCBI Official Synonym Full Names: major histocompatibility complex, class I, F
• NCBI Official Symbol: HLA-F
• NCBI Official Synonym Symbols: HLAF; CDA12; HLA-5.4; HLA-CDA12
• NCBI Protein Information: HLA class I histocompatibility antigen, alpha chain F
• UniProt Protein Name: HLA class I histocompatibility antigen, alpha chain F
• Protein Family: HLA class I histocompatibility antigen
• UniProt Gene Name: HLA-F
• UniProt Synonym Gene Names: HLA-5.4; HLAF
• UniProt Entry Name: HLAF_HUMAN

NCBI Description

This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain. [provided by RefSeq, Jul 2008]

Uniprot Description

HLA-F: Involved in the presentation of foreign antigens to the immune system. Belongs to the MHC class I family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi membrane; phagocytic vesicle membrane; cell surface; membrane; endoplasmic reticulum; early endosome membrane; plasma membrane; MHC class I protein complex

Molecular Function: TAP1 binding; peptide antigen binding; TAP2 binding; receptor binding

Biological Process: regulation of immune response; antigen processing and presentation of peptide antigen via MHC class I; positive regulation of T cell mediated cytotoxicity; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I