Rabbit anti-Human HLA-DQA1 Polyclonal Antibody | anti-HLA-DQA1 antibody

HLA-DQA1 Antibody - middle region

Cat. Num. AAA3221510

• Gene Names: HLA-DQA1; DQA1; DQ-A1; CELIAC1; HLA-DQA
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: HLA-DQA1; Polyclonal Antibody; HLA-DQA1 Antibody - middle region; anti-HLA-DQA1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT
• Sequence Length: 254

• Applicable Applications for anti-HLA-DQA1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLA-DQA1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HLA-DQA1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-HLA-DQA1 antibody

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation

Product Categories/Family for anti-HLA-DQA1 antibody

Polyclonal; Membrane Protein; Immunology; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 18426975
• NCBI GeneID: 3117
• NCBI Accession #: NP_002113.2
• NCBI GenBank Nucleotide #: NM_002122.3
• UniProt Accession #: P01909
• Molecular Weight: 27 kDa
• NCBI Official Full Name: HLA class II histocompatibility antigen, DQ alpha 1 chain
• NCBI Official Synonym Full Names: major histocompatibility complex, class II, DQ alpha 1
• NCBI Official Symbol: HLA-DQA1
• NCBI Official Synonym Symbols: DQA1; DQ-A1; CELIAC1; HLA-DQA
• NCBI Protein Information: HLA class II histocompatibility antigen, DQ alpha 1 chain
• UniProt Protein Name: HLA class II histocompatibility antigen, DQ alpha 1 chain
• Protein Family: HLA class II histocompatibility antigen
• UniProt Gene Name: HLA-DQA1
• UniProt Entry Name: DQA1_HUMAN

NCBI Description

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq, Jul 2008]

Uniprot Description

HLA-DQA1 iso4:

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi membrane; membrane; lysosomal membrane; integral to plasma membrane; plasma membrane; trans-Golgi network membrane; endosome membrane; MHC class II protein complex; external side of plasma membrane

Molecular Function: MHC class II receptor activity; peptide antigen binding

Biological Process: positive regulation of T cell differentiation; cytokine and chemokine mediated signaling pathway; T cell costimulation; antigen processing and presentation of exogenous peptide antigen via MHC class II; immune response; T cell receptor signaling pathway