Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HLA-DOB rabbit polyclonal antibody. Western Blot analysis of HLA-DOB expression in human placenta.)

Rabbit anti-Human HLA-DOB Polyclonal Antibody | anti-HLA-DOB antibody

HLA-DOB (HLA Class II Histocompatibility Antigen, DO beta Chain, MHC Class II Antigen DOB) (FITC)

Gene Names
HLA-DOB; DOB
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HLA-DOB; Polyclonal Antibody; HLA-DOB (HLA Class II Histocompatibility Antigen; DO beta Chain; MHC Class II Antigen DOB) (FITC); anti-HLA-DOB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HLA-DOB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-HLA-DOB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HLA-DOB, aa1-273 (NP_002111.1).
Immunogen Sequence
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HLA-DOB rabbit polyclonal antibody. Western Blot analysis of HLA-DOB expression in human placenta.)

Western Blot (WB) (HLA-DOB rabbit polyclonal antibody. Western Blot analysis of HLA-DOB expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of HLA-DOB expression in transfected 293T cell line by HLA-DOB polyclonal antibody. Lane 1: HLA-DOB transfected lysate (30.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HLA-DOB expression in transfected 293T cell line by HLA-DOB polyclonal antibody. Lane 1: HLA-DOB transfected lysate (30.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HLA-DOB antibody
Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM.
Product Categories/Family for anti-HLA-DOB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,822 Da
NCBI Official Full Name
HLA class II histocompatibility antigen, DO beta chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DO beta
NCBI Official Symbol
HLA-DOB
NCBI Official Synonym Symbols
DOB
NCBI Protein Information
HLA class II histocompatibility antigen, DO beta chain; MHC class II antigen DOB
UniProt Protein Name
HLA class II histocompatibility antigen, DO beta chain
UniProt Gene Name
HLA-DOB
UniProt Entry Name
DOB_HUMAN

NCBI Description

HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008]

Uniprot Description

HLA-DOB: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM. Belongs to the MHC class II family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: lysosomal membrane; lysosome; integral to membrane; endosome membrane; MHC class II protein complex

Molecular Function: MHC class II receptor activity

Biological Process: negative regulation of antigen processing and presentation of peptide antigen via MHC class II; antigen processing and presentation of exogenous peptide antigen via MHC class II; immune response; signal transduction

Research Articles on HLA-DOB

Similar Products

Product Notes

The HLA-DOB hla-dob (Catalog #AAA6381257) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLA-DOB (HLA Class II Histocompatibility Antigen, DO beta Chain, MHC Class II Antigen DOB) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-DOB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HLA-DOB hla-dob for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HLA-DOB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.