Western Blot (WB)
(WB Suggested Anti-HISPPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Rabbit HISPPD1 Polyclonal Antibody | anti-PPIP5K2 antibody
HISPPD1 antibody - middle region
Gene Names
PPIP5K2; VIP2; IP7K2; CFAP160; DFNB100; HISPPD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HISPPD1; Polyclonal Antibody; HISPPD1 antibody - middle region; anti-PPIP5K2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV
Sequence Length
1222
Applicable Applications for anti-PPIP5K2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HISPPD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HISPPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-HISPPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-PPIP5K2 antibody
This is a rabbit polyclonal antibody against HISPPD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively (Fridy et al., 2007 [PubMed 17690096]).[supplied by OMIM].
Target Description: Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively (Fridy et al., 2007 [PubMed 17690096]).[supplied by OMIM].
Product Categories/Family for anti-PPIP5K2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138kDa
NCBI Official Full Name
inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 isoform 2
NCBI Official Synonym Full Names
diphosphoinositol pentakisphosphate kinase 2
NCBI Official Symbol
PPIP5K2
NCBI Official Synonym Symbols
VIP2; IP7K2; CFAP160; DFNB100; HISPPD1
NCBI Protein Information
inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
UniProt Protein Name
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
UniProt Gene Name
PPIP5K2
UniProt Synonym Gene Names
HISPPD1; KIAA0433; VIP2; hsVIP2
UniProt Entry Name
VIP2_HUMAN
NCBI Description
This gene encodes a member of the histidine acid phosphatase family of proteins. Despite containing a histidine acid phosphatase domain, the encoded protein functions as an inositol pyrophosphate kinase, and is thought to lack phosphatase activity. This kinase activity is the mechanism by which the encoded protein synthesizes high-energy inositol pyrophosphates, which act as signaling molecules that regulate cellular homeostasis and other processes. This gene may be associated with autism spectrum disorder in human patients. [provided by RefSeq, Sep 2016]
Research Articles on PPIP5K2
Similar Products
Product Notes
The PPIP5K2 ppip5k2 (Catalog #AAA3212099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HISPPD1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HISPPD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPIP5K2 ppip5k2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLSSCQQRVK ARLHEILQKD RDFTAEDYEK LTPSGSISLI KSMHLIKNPV. It is sometimes possible for the material contained within the vial of "HISPPD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
