Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HIPK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

Rabbit HIPK1 Polyclonal Antibody | anti-HIPK1 antibody

HIPK1 antibody - middle region

Gene Names
HIPK1; Myak; Nbak2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIPK1; Polyclonal Antibody; HIPK1 antibody - middle region; anti-HIPK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
Sequence Length
1210
Applicable Applications for anti-HIPK1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HIPK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HIPK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-HIPK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Related Product Information for anti-HIPK1 antibody
This is a rabbit polyclonal antibody against HIPK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Full Name
homeodomain-interacting protein kinase 1 isoform 1
NCBI Official Synonym Full Names
homeodomain interacting protein kinase 1
NCBI Official Symbol
HIPK1
NCBI Official Synonym Symbols
Myak; Nbak2
NCBI Protein Information
homeodomain-interacting protein kinase 1
UniProt Protein Name
Homeodomain-interacting protein kinase 1
UniProt Gene Name
HIPK1
UniProt Synonym Gene Names
KIAA0630; MYAK; NBAK2
UniProt Entry Name
HIPK1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

HIPK1: homeodomain interacting protein kinase 1 is a CMGC kinase of the DYRK family. May play a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Expression elevated in many breast cancer cell lines. Null mice are resistant to carcinogens. Binds the p53 tumor suppressor. 4 alternatively spliced isoforms of the human protein have been described.

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; CMGC group; DYRK family; HIPK subfamily

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: PML body; cytoplasm; nuclear speck; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: neuron differentiation; anterior/posterior pattern formation; positive regulation of angiogenesis; smoothened signaling pathway; transcription, DNA-dependent; regulation of transcription, DNA-dependent; eye development; embryonic retina morphogenesis in camera-type eye; positive regulation of cell proliferation; embryonic camera-type eye morphogenesis; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; protein amino acid phosphorylation

Research Articles on HIPK1

Similar Products

Product Notes

The HIPK1 hipk1 (Catalog #AAA3212442) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIPK1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HIPK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIPK1 hipk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLNLSQNQQS SAAPTSQERS SNPAPRRQQA FVAPLSQAPY TFQHGSPLHS. It is sometimes possible for the material contained within the vial of "HIPK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.