HIF-1-alpha Polyclonal Antibody | anti-HIF-1-alpha antibody

Anti-HIF-1-alpha Antibody

Cat. Num. AAA177980

• Gene Names: HIF1A; HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: HIF-1-alpha; Polyclonal Antibody; Anti-HIF-1-alpha Antibody; Hypoxia-inducible factor 1-alpha; ARNT interacting protein; ARNT-interacting protein; Basic helix loop helix PAS protein MOP1; Basic-helix-loop-helix-PAS protein MOP1; bHLHe78; Class E basic helix-loop-helix protein 78; HIF 1A; HIF 1alpha; HIF1 A; HIF1 Alpha; HIF1; HIF1-alpha; HIF1A; HIF1A_HUMAN; Hypoxia inducible factor 1 alpha; Hypoxia inducible factor 1 alpha isoform I.3; Hypoxia inducible factor 1 alpha subunit; Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor; Hypoxia inducible factor 1; alpha subunit (basic helix loop helix transcription factor); Hypoxia inducible factor1alpha; Member of PAS protein 1; Member of PAS superfamily 1; Member of the PAS Superfamily 1; MOP 1; MOP1; PAS domain-containing protein 8; PASD 8; PASD8; hypoxia inducible factor 1; alpha subunit (basic helix-loop-helix transcription factor); anti-HIF-1-alpha antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 850

• Applicable Applications for anti-HIF-1-alpha antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- HIF 1 alpha Picoband antibody, MBS177980, Western blottingAll lanes: Anti HIF 1 alpha (MBS177980) at 0.5ug/mlWB: Recombinant Human HIF 1 alpha Protein 0.5ngPredicted bind size: 36KDObserved bind size: 36KD )

Western Blot (WB)

(Anti- HIF 1 alpha Picoband antibody, MBS177980, Western blottingAll lanes: Anti HIF 1 alpha (MBS177980) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SHG Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 93KDObserved bind size: 120KD )

Immunohistochemistry (IHC)

(Anti- HIF 1 alpha Picoband antibody, MBS177980,IHC(P)IHC(P): Mouse Intestine Tissue)

Immunohistochemistry (IHC)

(Anti- HIF 1 alpha Picoband antibody, MBS177980,IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- HIF 1 alpha Picoband antibody, MBS177980,IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-HIF-1-alpha antibody

Description: Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha(HIF1A) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HIF-1alpha (Hypoxia-inducible factor 1alpha, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1alpha transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1alpha regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.

References

1. Sutter, C. H.; Laughner, E.; Semenza, G. L. : Hypoxia-inducible factor 1-alpha protein expression is controlled by oxygen-regulated ubiquitination that is disrupted by deletions and missense mutations. Proc. Nat. Acad. Sci. 97: 4748-4753, 2000. 2. Elson, D. A.; Thurston, G.; Huang, L. E.; Ginzinger, D. G.; McDonald, D. M.; Johnson, R. S.; Arbeit, J. M. : Induction of hypervascularity without leakage or inflammation in transgenic mice overexpressing hypoxia-inducible factor-1-alpha. Genes Dev. 15: 2520-2532, 2001. 3. Koshiji, M.; To, K. K.-W.; Hammer, S.; Kumamoto, K.; Harris, A. L.; Modrich, P.; Huang, L. E. : HIF-1-alpha induces genetic instability by transcriptionally downregulating MutS-alpha expression. Molec. Cell 17: 793-803, 2005. 4. Ivan, M.; Kondo, K.; Yang, H.; Kim, W.; Valiando, J.; Ohh, M.; Salic, A.; Asara, J. M.; Lane, W. S.; Kaelin, W. G., Jr. : HIF-alpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O(2) sensing. Science 292: 464-468, 2001.

NCBI and Uniprot Product Information

• NCBI GI #: 340545531
• NCBI GeneID: 3091
• NCBI Accession #: NP_001230013.1
• NCBI GenBank Nucleotide #: NM_001243084.1
• UniProt Accession #: Q16665; Q53XP6; Q96PT9; Q9UPB1; C0LZJ3
• Molecular Weight: 95,634 Da
• NCBI Official Full Name: hypoxia-inducible factor 1-alpha isoform 3
• NCBI Official Synonym Full Names: hypoxia inducible factor 1 alpha subunit
• NCBI Official Symbol: HIF1A
• NCBI Official Synonym Symbols: HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha
• NCBI Protein Information: hypoxia-inducible factor 1-alpha
• UniProt Protein Name: Hypoxia-inducible factor 1-alpha
• UniProt Gene Name: HIF1A
• UniProt Synonym Gene Names: BHLHE78; MOP1; PASD8; HIF-1-alpha; HIF1-alpha; bHLHe78
• UniProt Entry Name: HIF1A_HUMAN

NCBI Description

This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2011]

Uniprot Description

HIF1A: a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP. Involved in the axonal distribution and transport of mitochondria in neurons during hypoxia. Interacts with the HIF1A beta/ARNT subunit; heterodimerization is required for DNA binding. Interacts with COPS5; the interaction increases the transcriptional activity of HIF1A through increased stability. Interacts with EP300 (via TAZ-type 1 domains); the interaction is stimulated in response to hypoxia and inhibited by CITED2. Interacts with CREBBP (via TAZ-type 1 domains). Interacts with NCOA1, NCOA2, APEX and HSP90. Interacts (hydroxylated within the ODD domain) with VHLL (via beta domain); the interaction, leads to polyubiquitination and subsequent HIF1A proteasomal degradation. During hypoxia, sumoylated HIF1A also binds VHL; the interaction promotes the ubiquitination of HIF1A. Interacts with SENP1; the interaction desumoylates HIF1A resulting in stabilization and activation of transcription. Interacts (Via the ODD domain) with ARD1A; the interaction appears not to acetylate HIF1A nor have any affect on protein stability, during hypoxia. Interacts with RWDD3; the interaction enhances HIF1A sumoylation. Interacts with TSGA10. Interacts with RORA (via the DNA binding domain); the interaction enhances HIF1A transcription under hypoxia through increasing protein stability. Interaction with PSMA7 inhibits the transactivation activity of HIF1A under both normoxic and hypoxia- mimicking conditions. Interacts with USP20. Interacts with RACK1; promotes HIF1A ubiquitination and proteasome- mediated degradation. Interacts (via N-terminus) with USP19. Under reduced oxygen tension. Induced also by various receptor-mediated factors such as growth factors, cytokines, and circulatory factors such as PDGF, EGF, FGF2, IGF2, TGFB1, HGF, TNF, IL1B, angiotensin-2 and thrombin. However, this induction is less intense than that stimulated by hypoxia. Repressed by HIPK2 and LIMD1. Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Autophagy

Chromosomal Location of Human Ortholog: 14q23.2

Cellular Component: cytoplasm; cytosol; nuclear speck; nucleoplasm; nucleus; transcription factor complex

Molecular Function: enzyme binding; histone acetyltransferase binding; histone deacetylase binding; Hsp90 protein binding; nuclear hormone receptor binding; protein binding; protein complex binding; protein heterodimerization activity; protein kinase binding; RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding; ubiquitin protein ligase binding

Biological Process: acute-phase response; angiogenesis; axon transport of mitochondrion; B-1 B cell homeostasis; cartilage development; cellular iron ion homeostasis; cellular response to insulin stimulus; cerebral cortex development; collagen metabolic process; connective tissue replacement during inflammatory response; digestive tract morphogenesis; elastin metabolic process; embryonic hemopoiesis; embryonic placenta development; epithelial to mesenchymal transition; heart looping; hemoglobin biosynthetic process; lactate metabolic process; lactation; maternal process involved in pregnancy; mRNA transcription from RNA polymerase II promoter; muscle maintenance; negative regulation of bone mineralization; negative regulation of growth; negative regulation of TOR signaling pathway; negative regulation of transcription from RNA polymerase II promoter; negative regulation of vasoconstriction; neural crest cell migration; neural fold elevation formation; oxygen homeostasis; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of cell size; positive regulation of chemokine production; positive regulation of endothelial cell proliferation; positive regulation of erythrocyte differentiation; positive regulation of glycolysis; positive regulation of hormone biosynthetic process; positive regulation of neuroblast proliferation; positive regulation of nitric-oxide synthase activity; positive regulation of smooth muscle cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of vascular endothelial growth factor receptor signaling pathway; regulation of gene expression; regulation of transcription from RNA polymerase II promoter in response to oxidative stress; regulation of transcription, DNA-dependent; regulation of transforming growth factor-beta2 production; response to alkaloid; response to estradiol stimulus; response to glucocorticoid stimulus; response to hypoxia; response to muscle activity; response to purine; response to salt stress; response to X-ray; signal transduction; transcription from RNA polymerase II promoter; visual learning