Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HGSNATSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlHGSNAT is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit HGSNAT Polyclonal Antibody | anti-HGSNAT antibody

HGSNAT Antibody - N-terminal region

Gene Names
HGSNAT; RP73; HGNAT; MPS3C; TMEM76
Reactivity
Dog, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HGSNAT; Polyclonal Antibody; HGSNAT Antibody - N-terminal region; anti-HGSNAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQAL
Sequence Length
219
Applicable Applications for anti-HGSNAT antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 82%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HGSNAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HGSNATSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlHGSNAT is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: HGSNATSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlHGSNAT is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-HGSNAT antibody
This is a rabbit polyclonal antibody against HGSNAT. It was validated on Western Blot

Target Description: This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate.
Product Categories/Family for anti-HGSNAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
HGSNAT protein
NCBI Official Synonym Full Names
heparan-alpha-glucosaminide N-acetyltransferase
NCBI Official Symbol
HGSNAT
NCBI Official Synonym Symbols
RP73; HGNAT; MPS3C; TMEM76
NCBI Protein Information
heparan-alpha-glucosaminide N-acetyltransferase

NCBI Description

This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeq, Jan 2009]

Research Articles on HGSNAT

Similar Products

Product Notes

The HGSNAT (Catalog #AAA3216908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HGSNAT Antibody - N-terminal region reacts with Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's HGSNAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HGSNAT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RALAALLLAA SVLSAALLAP GGSSGRDAQA APPRDLDKKR HAELKMDQAL. It is sometimes possible for the material contained within the vial of "HGSNAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.