Rabbit anti-Human Hepcidin (Hepc) Polyclonal Antibody | anti-Hepc antibody
Polyclonal Antibody to Hepcidin (Hepc)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-SVFPQQ TGQLAELQPQ DRAGARASWM PMFQRRRRRD THFPICIFCC GCCHRSKCGM CCKT
Immunohistochemistry: 5-20ug/mL
Immunocytochemistry: 5-20ug/mL
Optimal working dilutions must be determined by end user.
Store at 4ºC for frequent use.
Aliquot and store at -20ºC for 12 months.
Stability Test: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]
Uniprot Description
HAMP: Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. Defects in HAMP are the cause of hemochromatosis type 2B (HFE2B); also known as juvenile hemochromatosis (JH). HFE2B is a disorder of iron metabolism with excess deposition of iron in the tissues, bronze skin pigmentation, hepatic cirrhosis, arthropathy and diabetes. The most common symptoms of hemochromatosis type 2 at presentation are hypogonadism and cardiomyopathy. Belongs to the hepcidin family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 19q13.12
Cellular Component: apical cortex; extracellular region; extracellular space
Molecular Function: hormone activity
Biological Process: acute-phase response; aging; cellular iron ion homeostasis; defense response to bacterium; defense response to fungus; immune response; killing of cells of other organism; negative regulation of transcription from RNA polymerase II promoter; response to ethanol; response to iron ion; response to vitamin A; response to zinc ion
Disease: Hemochromatosis, Type 2b
Research Articles on Hepc
Similar Products
Product Notes
The Hepc hamp (Catalog #AAA2003456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Hepcidin (Hepc) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Hepcidin (Hepc) can be used in a range of immunoassay formats including, but not limited to, WB; IHC; ICC; IP. Western blotting: 0.5-2ug/mL Immunohistochemistry: 5-20ug/mL Immunocytochemistry: 5-20ug/mL Optimal working dilutions must be determined by end user. Researchers should empirically determine the suitability of the Hepc hamp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-SVFPQQ TGQLAELQPQ DRAGARASWM PMFQRRRRRD THFPICIFCC GCCHRSKCGM CCKT. It is sometimes possible for the material contained within the vial of "Hepcidin (Hepc), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.