Western Blot (WB)
(WB Suggested Anti-HELB Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Rabbit HELB Polyclonal Antibody | anti-HELB antibody
HELB antibody - N-terminal region
Gene Names
HELB; DHB; hDHB
Reactivity
Cow, Guinea Pig, Human, Pig, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
HELB; Polyclonal Antibody; HELB antibody - N-terminal region; anti-HELB antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI
Sequence Length
1087
Applicable Applications for anti-HELB antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 79%; Human: 100%; Pig: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HELB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HELB Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-HELB Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HELB antibody
This is a rabbit polyclonal antibody against HELB. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene is a DNA helicase. A dominant-negative mutant of this protein blocks chromosomal DNA replication and suggests that its function is required for S phase entry.
Target Description: The protein encoded by this gene is a DNA helicase. A dominant-negative mutant of this protein blocks chromosomal DNA replication and suggests that its function is required for S phase entry.
Product Categories/Family for anti-HELB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
DNA helicase B
NCBI Official Synonym Full Names
DNA helicase B
NCBI Official Symbol
HELB
NCBI Official Synonym Symbols
DHB; hDHB
NCBI Protein Information
DNA helicase B
UniProt Protein Name
DNA helicase B
Protein Family
UniProt Gene Name
HELB
UniProt Synonym Gene Names
hDHB
UniProt Entry Name
HELB_HUMAN
NCBI Description
This gene encodes a DNA-dependent ATPase which catalyzes the unwinding of DNA necessary for DNA replication, repair, recombination, and transcription. This gene is thought to function specifically during the S phase entry of the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Research Articles on HELB
1. Conclude that mammalian DNA end resection triggers its own inhibition via the recruitment of HELB.
Similar Products
Product Notes
The HELB helb (Catalog #AAA3203168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HELB antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HELB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HELB helb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGRFPITGAW WRVKVQVKPV VGSRSYQYQV QGFPSYFLQS DMSPPNQKHI. It is sometimes possible for the material contained within the vial of "HELB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
