Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chromatin Immunoprecipitation (ChIP) (Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region and HCT116 Cells)

Rabbit HDAC9 Polyclonal Antibody | anti-HDAC9 antibody

HDAC9 antibody - C-terminal region

Gene Names
HDAC9; HD7; HD9; HD7b; HDAC; HDRP; MITR; HDAC7; HDAC7B; HDAC9B; HDAC9FL
Reactivity
Guinea Pig, Human, Mouse, Sheep
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
HDAC9; Polyclonal Antibody; HDAC9 antibody - C-terminal region; anti-HDAC9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
Sequence Length
590
Applicable Applications for anti-HDAC9 antibody
Chromatin IP (ChIP), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Chromatin Immunoprecipitation (ChIP)

(Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region and HCT116 Cells)

Chromatin Immunoprecipitation (ChIP) (Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region and HCT116 Cells)

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Rabbit Anti-HDAC9 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-HDAC9 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: HDAC9Sample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HDAC9Sample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-HDAC9 Antibody Titration: 1.25ug/mlPositive Control: A172 cell lysateHDAC9 is supported by BioGPS gene expression data to be expressed in A172)

Western Blot (WB) (WB Suggested Anti-HDAC9 Antibody Titration: 1.25ug/mlPositive Control: A172 cell lysateHDAC9 is supported by BioGPS gene expression data to be expressed in A172)
Related Product Information for anti-HDAC9 antibody
This is a rabbit polyclonal antibody against HDAC9. It was validated on Western Blot and immunohistochemistry

Target Description: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
histone deacetylase 9 isoform 3
NCBI Official Synonym Full Names
histone deacetylase 9
NCBI Official Symbol
HDAC9
NCBI Official Synonym Symbols
HD7; HD9; HD7b; HDAC; HDRP; MITR; HDAC7; HDAC7B; HDAC9B; HDAC9FL
NCBI Protein Information
histone deacetylase 9
UniProt Protein Name
Histone deacetylase 9
UniProt Gene Name
HDAC9
UniProt Synonym Gene Names
HDAC7; HDAC7B; HDRP; KIAA0744; MITR; HD9; HD7; HD7b
UniProt Entry Name
HDAC9_HUMAN

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

HDAC9: a transcriptional regulator of the histone deacetylase family, subfamily 2. Deacetylates lysine residues on the N-terminal part of the core histones H2A, H2B, H3 AND H4. Plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.

Protein type: Transcription, coactivator/corepressor; Deacetylase; EC 3.5.1.98

Chromosomal Location of Human Ortholog: 7p21.1

Cellular Component: nucleoplasm; histone methyltransferase complex; transcription factor complex; histone deacetylase complex; cytoplasm; nucleus

Molecular Function: protein binding; NAD-dependent histone deacetylase activity (H3-K9 specific); protein kinase C binding; NAD-dependent histone deacetylase activity (H3-K14 specific); histone deacetylase binding; metal ion binding; protein deacetylase activity; NAD-dependent histone deacetylase activity (H4-K16 specific); histone deacetylase activity; transcription corepressor activity; transcription factor binding

Biological Process: Notch signaling pathway; regulation of skeletal muscle fiber development; B cell activation; transcription, DNA-dependent; cellular response to insulin stimulus; regulation of striated muscle cell differentiation; B cell differentiation; heart development; histone deacetylation; negative regulation of transcription from RNA polymerase II promoter; inflammatory response; negative regulation of transcription, DNA-dependent

Research Articles on HDAC9

Similar Products

Product Notes

The HDAC9 hdac9 (Catalog #AAA3206552) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC9 antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC9 can be used in a range of immunoassay formats including, but not limited to, Chromatin IP (ChIP), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HDAC9 hdac9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVGAVKVKEE PVDSDEDAQI QEMESGEQAA FMQQVIGKDL APGFVIKVII. It is sometimes possible for the material contained within the vial of "HDAC9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.