Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HDAC3 expression in transfected 293T cell line y HDAC3 polyclonal antibody. Lane 1: HDAC3 transfected lysate (48.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HDAC3 Polyclonal Antibody | anti-HDAC3 antibody

HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (FITC)

Gene Names
HDAC3; HD3; RPD3; RPD3-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HDAC3; Polyclonal Antibody; HDAC3 (Histone Deacetylase 3; HD3; RPD3-2; SMAP45; RPD3) (FITC); anti-HDAC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HDAC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-HDAC3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HDAC3, aa1-428 (NP_003874.2).
Immunogen Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HDAC3 expression in transfected 293T cell line y HDAC3 polyclonal antibody. Lane 1: HDAC3 transfected lysate (48.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HDAC3 expression in transfected 293T cell line y HDAC3 polyclonal antibody. Lane 1: HDAC3 transfected lysate (48.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HDAC3 antibody
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation.
Product Categories/Family for anti-HDAC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,848 Da
NCBI Official Full Name
histone deacetylase 3
NCBI Official Synonym Full Names
histone deacetylase 3
NCBI Official Symbol
HDAC3
NCBI Official Synonym Symbols
HD3; RPD3; RPD3-2
NCBI Protein Information
histone deacetylase 3; SMAP45
UniProt Protein Name
Histone deacetylase 3
Protein Family
UniProt Gene Name
HDAC3
UniProt Synonym Gene Names
HD3
UniProt Entry Name
HDAC3_HUMAN

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HDAC3: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation. Interacts with HDAC7 and HDAC9. Forms a heterologous complex at least with YY1. Interacts with DAXX, HDAC10 and DACH1. Found in a complex with NCOR1 and NCOR2. Component of the N-Cor repressor complex, at least composed of NCOR1, NCOR2, HDAC3, TBL1X, TBL1R, CORO2A and GPS2. Interacts with BCOR, MJD2A/JHDM3A, NRIP1, PRDM6 and SRY. Interacts with BTBD14B. Interacts with GLIS2. Interacts (via the DNA-binding domain) with NR2C1; the interaction recruits phosphorylated NR2C1 to PML bodies for sumoylation. Component of the Notch corepressor complex. Interacts with CBFA2T3 and NKAP. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with and deacetylates MAPK14. Interacts with ZMYND15. Widely expressed. Belongs to the histone deacetylase family. HD type 1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Apoptosis; Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Deacetylase; EC 3.5.1.98

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; Golgi apparatus; transcriptional repressor complex; spindle microtubule; cytoplasm; histone deacetylase complex; plasma membrane; nucleus

Molecular Function: protein binding; cyclin binding; NAD-dependent histone deacetylase activity (H3-K9 specific); enzyme binding; NAD-dependent histone deacetylase activity (H3-K14 specific); chromatin DNA binding; histone deacetylase binding; protein deacetylase activity; NAD-dependent histone deacetylase activity (H4-K16 specific); chromatin binding; histone deacetylase activity; transcription factor binding; transcription corepressor activity

Biological Process: circadian rhythm; negative regulation of JNK cascade; establishment and/or maintenance of chromatin architecture; Notch signaling pathway; transcription, DNA-dependent; nerve growth factor receptor signaling pathway; regulation of mitotic cell cycle; regulation of multicellular organism growth; regulation of protein stability; chromatin modification; spindle assembly; cellular lipid metabolic process; negative regulation of transcription from RNA polymerase II promoter; negative regulation of cell cycle; protein amino acid deacetylation; positive regulation of transcription factor import into nucleus; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent; positive regulation of TOR signaling pathway; negative regulation of apoptosis

Research Articles on HDAC3

Similar Products

Product Notes

The HDAC3 hdac3 (Catalog #AAA6380883) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HDAC3 hdac3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HDAC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.