Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HBEGF expression in transfected 293T cell line by HBEGF MaxPab polyclonal antibody.Lane 1: HBEGF transfected lysate(23.10 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human HBEGF Polyclonal Antibody | anti-HBEGF antibody

HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) (APC)

Gene Names
HBEGF; DTR; DTS; DTSF; HEGFL
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
HBEGF; Polyclonal Antibody; HBEGF (heparin-Binding EGF-like Growth Factor; DTR; DTS; DTSF; HEGFL) (APC); heparin-Binding EGF-like Growth Factor; HEGFL; anti-HBEGF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HBEGF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HBEGF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HBEGF (NP_001936.1, 1aa-208aa) full-length human protein.
Immunogen Sequence
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HBEGF expression in transfected 293T cell line by HBEGF MaxPab polyclonal antibody.Lane 1: HBEGF transfected lysate(23.10 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HBEGF expression in transfected 293T cell line by HBEGF MaxPab polyclonal antibody.Lane 1: HBEGF transfected lysate(23.10 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(HBEGF MaxPab rabbit polyclonal antibody. Western Blot analysis of HBEGF expression in human liver.)

Western Blot (WB) (HBEGF MaxPab rabbit polyclonal antibody. Western Blot analysis of HBEGF expression in human liver.)
Related Product Information for anti-HBEGF antibody
Rabbit polyclonal antibody raised against a full-length human HBEGF protein.
Product Categories/Family for anti-HBEGF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,067 Da
NCBI Official Full Name
proheparin-binding EGF-like growth factor
NCBI Official Synonym Full Names
heparin-binding EGF-like growth factor
NCBI Official Symbol
HBEGF
NCBI Official Synonym Symbols
DTR; DTS; DTSF; HEGFL
NCBI Protein Information
proheparin-binding EGF-like growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor)
UniProt Protein Name
Proheparin-binding EGF-like growth factor
UniProt Gene Name
HBEGF
UniProt Synonym Gene Names
DTR; DTS; HEGFL; HB-EGF; HBEGF; DT-R
UniProt Entry Name
HBEGF_HUMAN

Uniprot Description

HBEGF: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 5q23

Cellular Component: extracellular space; cell surface; integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: heparin binding; growth factor activity; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of keratinocyte migration; muscle development; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; negative regulation of elastin biosynthetic process; positive regulation of smooth muscle cell proliferation; pathogenesis; signal transduction; positive regulation of cell growth; regulation of heart contraction; positive regulation of protein kinase B signaling cascade; positive regulation of cell proliferation; innate immune response; wound healing, spreading of epidermal cells; positive regulation of cell migration

Research Articles on HBEGF

Similar Products

Product Notes

The HBEGF hbegf (Catalog #AAA6451070) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HBEGF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HBEGF hbegf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HBEGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.