Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of H1FOO expression in transfected 293T cell line by H1FOO polyclonal antibody. Lane 1: H1FOO transfected lysate (22.77kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human H1FOO Polyclonal Antibody | anti-H1FOO antibody

H1FOO (Histone H1oo, Oocyte-specific histone H1, Oocyte-specific Linker Histone H1, osH1, H1OO, OSH1 MGC50807)

Gene Names
H1FOO; osH1
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
H1FOO; Polyclonal Antibody; H1FOO (Histone H1oo; Oocyte-specific histone H1; Oocyte-specific Linker Histone H1; osH1; H1OO; OSH1 MGC50807); Anti -H1FOO (Histone H1oo; anti-H1FOO antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human H1FOO.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA
Applicable Applications for anti-H1FOO antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human H1FOO, aa1-207 (AAH47943.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of H1FOO expression in transfected 293T cell line by H1FOO polyclonal antibody. Lane 1: H1FOO transfected lysate (22.77kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of H1FOO expression in transfected 293T cell line by H1FOO polyclonal antibody. Lane 1: H1FOO transfected lysate (22.77kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to H1FOO on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to H1FOO on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-H1FOO antibody
May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling.
Product Categories/Family for anti-H1FOO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,813 Da
NCBI Official Full Name
histone H1oo
NCBI Official Synonym Full Names
H1 histone family, member O, oocyte-specific
NCBI Official Symbol
H1FOO
NCBI Official Synonym Symbols
osH1
NCBI Protein Information
histone H1oo; oocyte-specific histone H1; oocyte-specific linker histone H1
UniProt Protein Name
Histone H1oo
Protein Family
UniProt Gene Name
H1FOO
UniProt Synonym Gene Names
H1OO; OSH1; osH1
UniProt Entry Name
H1FOO_HUMAN

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The protein encoded is a member of the histone H1 family. The related mouse gene is expressed only in oocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

H1FOO: May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling. Belongs to the histone H1/H5 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: cytoplasm; nucleolus; nucleosome; nucleus; female germ cell nucleus

Molecular Function: nucleosomal DNA binding

Biological Process: nucleosome assembly; meiotic cell cycle; nucleosome positioning

Research Articles on H1FOO

Similar Products

Product Notes

The H1FOO h1foo (Catalog #AAA644649) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The H1FOO (Histone H1oo, Oocyte-specific histone H1, Oocyte-specific Linker Histone H1, osH1, H1OO, OSH1 MGC50807) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's H1FOO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the H1FOO h1foo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPATAPRRA GEAKGKGPKK PSEAKEDPPN VGKVKKAAKR PAKVQKPPPK PGAATEKARK QGGAAKDTRA QSGEARKVPP KPDKAMRAPS SAGGLSRKAK AKGSRSSQGD AEAYRKTKAE SKSSKPTASK VKNGAASPTK KKVVAKAKAP KAGQGPNTKA AAPAKGSGSK VVPAHLSRKT EAPKGPRKAG LPIKASSSKV SSQRAEA. It is sometimes possible for the material contained within the vial of "H1FOO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.