Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GUCY1B3Sample Tissue: Human HepG2 Whole cellAntibody Dilution: 1ug/ml)

Rabbit GUCY1B1 Polyclonal Antibody | anti-GUCY1B1 antibody

GUCY1B1 Antibody

Gene Names
GUCY1B1; GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Purity
Affinity Purified
Synonyms
GUCY1B1; Polyclonal Antibody; GUCY1B1 Antibody; anti-GUCY1B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
Sequence Length
619
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GUCY1B3Sample Tissue: Human HepG2 Whole cellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GUCY1B3Sample Tissue: Human HepG2 Whole cellAntibody Dilution: 1ug/ml)
Related Product Information for anti-GUCY1B1 antibody
guanylate cyclase 1, soluble, beta 3

Target Description: This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-GUCY1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71 kDa
NCBI Official Full Name
guanylate cyclase soluble subunit beta-1 isoform 2
NCBI Official Synonym Full Names
guanylate cyclase 1 soluble subunit beta 1
NCBI Official Symbol
GUCY1B1
NCBI Official Synonym Symbols
GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1
NCBI Protein Information
guanylate cyclase soluble subunit beta-1
UniProt Protein Name
Guanylate cyclase soluble subunit beta-1
UniProt Gene Name
GUCY1B3
UniProt Synonym Gene Names
GUC1B3; GUCSB3; GUCY1B1; GCS-beta-1; GCS-beta-3
UniProt Entry Name
GCYB1_HUMAN

NCBI Description

This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

GUCY1B3: Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. Heterodimer of an alpha and a beta chain. 2 isoforms of the human protein are produced by alternative splicing

Protein type: EC 4.6.1.2; Guanylyl cyclase; Nucleotide Metabolism - purine; Receptor, misc.; Lyase

Chromosomal Location of Human Ortholog: 4q31.3-q33

Cellular Component: guanylate cyclase complex, soluble; intracellular membrane-bound organelle; cytoplasm

Molecular Function: guanylate cyclase activity; GTP binding; protein heterodimerization activity; metal ion binding; heme binding; Hsp90 protein binding; receptor activity

Biological Process: cGMP biosynthetic process; blood circulation; blood coagulation; nitric oxide mediated signal transduction

Research Articles on GUCY1B1

Similar Products

Product Notes

The GUCY1B1 gucy1b3 (Catalog #AAA3207994) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUCY1B1 Antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTGVIGQRMP RYCLFGNTVN LTSRTETTGE KGKINVSEYT YRCLMSPENS. It is sometimes possible for the material contained within the vial of "GUCY1B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.