Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GTPBP5 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Rabbit GTPBP5 Polyclonal Antibody | anti-MTG2 antibody

GTPBP5 Antibody - N-terminal region

Gene Names
MTG2; ObgH1; GTPBP5; dJ1005F21.2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GTPBP5; Polyclonal Antibody; GTPBP5 Antibody - N-terminal region; anti-MTG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDE
Sequence Length
406
Applicable Applications for anti-MTG2 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of GTPBP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GTPBP5 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Western Blot (WB) (WB Suggested Anti-GTPBP5 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Related Product Information for anti-MTG2 antibody
This is a rabbit polyclonal antibody against GTPBP5. It was validated on Western Blot

Target Description: Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction .
Product Categories/Family for anti-MTG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
mitochondrial ribosome-associated GTPase 2
NCBI Official Synonym Full Names
mitochondrial ribosome associated GTPase 2
NCBI Official Symbol
MTG2
NCBI Official Synonym Symbols
ObgH1; GTPBP5; dJ1005F21.2
NCBI Protein Information
mitochondrial ribosome-associated GTPase 2
UniProt Protein Name
Mitochondrial ribosome-associated GTPase 2
Protein Family
UniProt Gene Name
MTG2
UniProt Synonym Gene Names
GTPBP5; OBGH1; ObgH1

NCBI Description

Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM, Mar 2008]

Uniprot Description

Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays GTPase activity. Involved in the ribosome maturation process.

Research Articles on MTG2

Similar Products

Product Notes

The MTG2 mtg2 (Catalog #AAA3215761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTPBP5 Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GTPBP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTG2 mtg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRYQGFSGED GGSKNCFGRS GAVLYIRVPV GTLVKEGGRV VADLSCVGDE. It is sometimes possible for the material contained within the vial of "GTPBP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.