Rabbit anti-Human GTF2H2 Polyclonal Antibody | anti-GTF2H2 antibody

GTF2H2 (General Transcription Factor IIH Subunit 2, General Transcription Factor IIH Polypeptide 2, TFIIH Basal Transcription Factor Complex p44 Subunit, Basic Transcription Factor 2 44kD Subunit, BTF2-p44, BTF2P44) (HRP)

Cat. Num. AAA6380543

• Gene Names: GTF2H2; p44; BTF2; TFIIH; BTF2P44; T-BTF2P44
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GTF2H2; Polyclonal Antibody; GTF2H2 (General Transcription Factor IIH Subunit 2; General Transcription Factor IIH Polypeptide 2; TFIIH Basal Transcription Factor Complex p44 Subunit; Basic Transcription Factor 2 44kD Subunit; BTF2-p44; BTF2P44) (HRP); anti-GTF2H2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GTF2H2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-GTF2H2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GTF2H2, aa1-395 (NP_001506.1).
• Immunogen Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GTF2H2 expression in transfected 293T cell line by GTF2H2 polyclonal antibody. Lane 1: GTF2H2 transfected lysate (44.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GTF2H2 antibody

GTF2H2 is the 44kD subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair.

Product Categories/Family for anti-GTF2H2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 6681762
• NCBI GeneID: 2966
• NCBI Accession #: NP_001506.1
• NCBI GenBank Nucleotide #: NM_001515.2
• UniProt Accession #: Q13888; Q15570; Q15571; Q9BS41
• Molecular Weight: 44,419 Da
• NCBI Official Full Name: general transcription factor IIH subunit 2
• NCBI Official Synonym Full Names: general transcription factor IIH, polypeptide 2, 44kDa
• NCBI Official Symbol: GTF2H2
• NCBI Official Synonym Symbols: p44; BTF2; TFIIH; BTF2P44; T-BTF2P44
• NCBI Protein Information: general transcription factor IIH subunit 2; BTF2 p44; basic transcription factor 2 44 kDa subunit; general transcription factor IIH polypeptide 2; TFIIH basal transcription factor complex p44 subunit; general transcription factor IIH, polypeptide 2, 44kD
• UniProt Protein Name: General transcription factor IIH subunit 2
• Protein Family: General transcription factor
• UniProt Gene Name: GTF2H2
• UniProt Synonym Gene Names: BTF2P44; BTF2 p44
• UniProt Entry Name: TF2H2_HUMAN

NCBI Description

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GTF2H2: Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. The N-terminus interacts with and regulates XPD whereas an intact C- terminus is required for a successful escape of RNAP II form the promoter. Belongs to the GTF2H2 family. 1 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; DNA repair, damage; Ubiquitin ligase; Transcription factor

Chromosomal Location of Human Ortholog: 5q13.2

Cellular Component: nucleoplasm; holo TFIIH complex

Molecular Function: RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; protein binding; nucleic acid binding; zinc ion binding; translation factor activity, nucleic acid binding; protein N-terminus binding; transcription factor activity; protein kinase activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; translation; viral reproduction; positive regulation of viral transcription; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; DNA repair; termination of RNA polymerase I transcription; protein amino acid phosphorylation; regulation of gene expression, epigenetic; mRNA capping; G-protein coupled receptor internalization; regulation of transcription, DNA-dependent; negative regulation of gene expression, epigenetic; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; gene expression; nucleotide-excision repair, DNA damage removal; transcription initiation from RNA polymerase I promoter; response to UV