Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GTF2F1 Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysateThere is BioGPS gene expression data showing that GTF2F1 is expressed in K562)

Rabbit GTF2F1 Polyclonal Antibody | anti-GTF2F1 antibody

GTF2F1 antibody - N-terminal region

Gene Names
GTF2F1; BTF4; RAP74; TF2F1; TFIIF
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GTF2F1; Polyclonal Antibody; GTF2F1 antibody - N-terminal region; anti-GTF2F1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD
Sequence Length
517
Applicable Applications for anti-GTF2F1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2F1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GTF2F1 Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysateThere is BioGPS gene expression data showing that GTF2F1 is expressed in K562)

Western Blot (WB) (WB Suggested Anti-GTF2F1 Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysateThere is BioGPS gene expression data showing that GTF2F1 is expressed in K562)
Related Product Information for anti-GTF2F1 antibody
This is a rabbit polyclonal antibody against GTF2F1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GTF2F1 is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
Product Categories/Family for anti-GTF2F1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
general transcription factor IIF subunit 1
NCBI Official Synonym Full Names
general transcription factor IIF subunit 1
NCBI Official Symbol
GTF2F1
NCBI Official Synonym Symbols
BTF4; RAP74; TF2F1; TFIIF
NCBI Protein Information
general transcription factor IIF subunit 1
UniProt Protein Name
General transcription factor IIF subunit 1
UniProt Gene Name
GTF2F1
UniProt Synonym Gene Names
RAP74; TFIIF-alpha
UniProt Entry Name
T2FA_HUMAN

Uniprot Description

GTF2F1: TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. Heterodimer of an alpha and a beta subunit. Interacts with GTF2F2, CTDP1, TAF6/TAFII80 and URI1. Up-regulated in response to enterovirus 71 (EV71) infection. Belongs to the TFIIF alpha subunit family.

Protein type: Kinase, protein; EC 2.7.11.1; Transcription initiation complex; ATYPICAL group; GTF2F1 family

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; transcription factor TFIIF complex; cell junction; nucleus

Molecular Function: protein binding; DNA binding; phosphatase activator activity; transcription coactivator activity; transcription factor binding; catalytic activity

Biological Process: positive regulation of catalytic activity; transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; transcription initiation from RNA polymerase II promoter; mRNA capping; viral reproduction; positive regulation of RNA elongation from RNA polymerase II promoter; positive regulation of viral transcription; RNA splicing; response to virus; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on GTF2F1

Similar Products

Product Notes

The GTF2F1 gtf2f1 (Catalog #AAA3224606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2F1 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2F1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GTF2F1 gtf2f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAALGPSSQN VTEYVVRVPK NTTKKYNIMA FNAADKVNFA TWNQARLERD. It is sometimes possible for the material contained within the vial of "GTF2F1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.