Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GTF2E2Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GTF2E2 Polyclonal Antibody | anti-GTF2E2 antibody

GTF2E2 Antibody - middle region

Gene Names
GTF2E2; FE; TTD6; TF2E2; TFIIE-B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GTF2E2; Polyclonal Antibody; GTF2E2 Antibody - middle region; anti-GTF2E2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGD
Sequence Length
291
Applicable Applications for anti-GTF2E2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human GTF2E2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GTF2E2Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GTF2E2Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GTF2E2 antibody
Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
Product Categories/Family for anti-GTF2E2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
transcription initiation factor IIE subunit beta isoform 1
NCBI Official Synonym Full Names
general transcription factor IIE subunit 2
NCBI Official Symbol
GTF2E2
NCBI Official Synonym Symbols
FE; TTD6; TF2E2; TFIIE-B
NCBI Protein Information
transcription initiation factor IIE subunit beta
UniProt Protein Name
Transcription initiation factor IIE subunit beta
UniProt Gene Name
GTF2E2
UniProt Synonym Gene Names
TF2E2; TFIIE-beta
UniProt Entry Name
T2EB_HUMAN

NCBI Description

The general transcription factor IIE (TFIIE) is part of the RNA polymerase II transcription initiation complex, recruiting TFIIH and being essential for promoter clearance by RNA polymerase II. TFIIE is a heterodimer (and sometimes heterotetramer) of alpha and beta subunits. The protein encoded by this gene represents the beta subunit of TFIIE. [provided by RefSeq, Jan 2017]

Uniprot Description

GTF2E2: Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase. Belongs to the TFIIE beta subunit family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: nucleoplasm; cytoplasm; transcription factor TFIIE complex; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; regulation of transcription, DNA-dependent; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on GTF2E2

Similar Products

Product Notes

The GTF2E2 gtf2e2 (Catalog #AAA3222238) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2E2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2E2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GTF2E2 gtf2e2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHGGSSGSKQ NSDHSNGSFN LKALSGSSGY KFGVLAKIVN YMKTRHQRGD. It is sometimes possible for the material contained within the vial of "GTF2E2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.