Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Intestine)

Rabbit GTF2B Polyclonal Antibody | anti-GTF2B antibody

GTF2B antibody - N-terminal region

Gene Names
GTF2B; TF2B; TFIIB
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
GTF2B; Polyclonal Antibody; GTF2B antibody - N-terminal region; anti-GTF2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK
Sequence Length
316
Applicable Applications for anti-GTF2B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Intestine)

Immunohistochemistry (IHC) (Human Intestine)

Western Blot (WB)

(Host: RatTarget Name: GTF2BSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: GTF2BSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GTF2B Antibody Titration: 4.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-GTF2B Antibody Titration: 4.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-GTF2B antibody
This is a rabbit polyclonal antibody against GTF2B. It was validated on Western Blot and immunohistochemistry

Target Description: GTF2B is the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
transcription initiation factor IIB
NCBI Official Synonym Full Names
general transcription factor IIB
NCBI Official Symbol
GTF2B
NCBI Official Synonym Symbols
TF2B; TFIIB
NCBI Protein Information
transcription initiation factor IIB
UniProt Protein Name
Transcription initiation factor IIB
UniProt Gene Name
GTF2B
UniProt Synonym Gene Names
TF2B; TFIIB
UniProt Entry Name
TF2B_HUMAN

NCBI Description

This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq, Jul 2008]

Uniprot Description

GTF2B: General factor that plays a major role in the activation of eukaryotic genes transcribed by RNA polymerase II. Associates with TFIID-IIA (DA complex) to form TFIID-IIA- IIB (DAB-complex) which is then recognized by polymerase II. Interacts with the transcription elongation factor TCEA2. Interacts with HIV-1 Vpr. Interacts with GPBP1. Interacts with Epstein-Barr virus EBNA2. Belongs to the TFIIB family.

Protein type: Transcription factor; Nuclear receptor co-regulator; Acetyltransferase

Chromosomal Location of Human Ortholog: 1p22-p21

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: protein binding; zinc ion binding; TATA-binding protein binding; thyroid hormone receptor binding; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; regulation of transcription, DNA-dependent; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on GTF2B

Similar Products

Product Notes

The GTF2B gtf2b (Catalog #AAA3224709) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2B antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GTF2B gtf2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLPRNIVDRT NNLFKQVYEQ KSLKGRANDA IASACLYIAC RQEGVPRTFK. It is sometimes possible for the material contained within the vial of "GTF2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.