Rabbit anti-Human GSTK1 Polyclonal Antibody | anti-GSTK1 antibody

GSTK1 (Glutathione S-transferase kappa 1, GST 13-13, GST Class-kappa, GSTK1-1, Glutathione S-transferase Subunit 13, HDCMD47P) (PE)

Cat. Num. AAA6380406

• Gene Names: GSTK1; GST; GST13; hGSTK1; GSTK1-1; GST13-13; GST 13-13
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTK1; Polyclonal Antibody; GSTK1 (Glutathione S-transferase kappa 1; GST 13-13; GST Class-kappa; GSTK1-1; Glutathione S-transferase Subunit 13; HDCMD47P) (PE); anti-GSTK1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSTK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-GSTK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSTK1, aa1-226 (NP_057001.1).
• Immunogen Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSTK1 rabbit polyclonal antibody. Western Blot analysis of GSTK1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of GSTK1 expression in transfected 293T cell line by GSTK1 polyclonal antibody. Lane 1: GSTK1 transfected lysate (25.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GSTK1 antibody

Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).

Product Categories/Family for anti-GSTK1 antibody

Antibodies; GST

NCBI and Uniprot Product Information

• NCBI GI #: 7705704
• NCBI GeneID: 373156
• NCBI Accession #: NP_057001.1
• NCBI GenBank Nucleotide #: NM_015917.1
• UniProt Accession #: Q9Y2Q3; Q6P4H0; Q7Z520; Q9P1S4; B4DIH1; B4DSY2
• Molecular Weight: 20,538 Da
• NCBI Official Full Name: glutathione S-transferase kappa 1 isoform a
• NCBI Official Synonym Full Names: glutathione S-transferase kappa 1
• NCBI Official Symbol: GSTK1
• NCBI Official Synonym Symbols: GST; GST13; hGSTK1; GSTK1-1; GST13-13; GST 13-13
• NCBI Protein Information: glutathione S-transferase kappa 1; GST class-kappa; glutathione S-transferase k1; glutathione S-transferase subunit 13 homolog
• UniProt Protein Name: Glutathione S-transferase kappa 1
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTK1
• UniProt Synonym Gene Names: hGSTK1
• UniProt Entry Name: GSTK1_HUMAN

NCBI Description

This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009]

Uniprot Description

GSTK1: Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). Belongs to the GST superfamily. Kappa family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.5.1.18; Xenobiotic Metabolism - metabolism by cytochrome P450; Other Amino Acids Metabolism - glutathione; Transferase; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: membrane; intracellular membrane-bound organelle; mitochondrial matrix; mitochondrial inner membrane; peroxisome; intracellular

Molecular Function: glutathione transferase activity; protein disulfide oxidoreductase activity; glutathione peroxidase activity; receptor binding

Biological Process: glutathione metabolic process; epithelial cell differentiation